HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A093CFL7",
"id": "A0A093CFL7_9AVES",
"source_organism": {
"taxId": "240206",
"scientificName": "Pterocles gutturalis",
"fullName": "Pterocles gutturalis (yellow-throated sandgrouse)"
},
"name": "E2F/DP family winged-helix DNA-binding domain-containing protein",
"description": null,
"length": 341,
"sequence": "AADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAGCNTKEVVDRLRYLEAEIEDLELKEKELDQQKLWLQQSIKNVMDDSTNHQYPFKLIVCILELELKQQLKCKTLCRDTLLAIRAPCGTQLEVPIPEMGQNGQKKYQINLKSSSGPIHVLLINKESSSSKPMVFPVPPPDDLAQPPFQPAAPETPLKAATAPQNPPEQHDLNQGQELPQTSVADTPSGGSRIFPTSDGWGRKGDEPVLYPSLSGDVAQATASSNDYQGLLPLDVNCILKPNSFDIAKMEEPTGNISGDIIDELMSSDVFPLLRLSPTPGDDYNFNLDDNEGVCDLFDVQILN",
"proteome": "UP000053149",
"gene": "N339_10667",
"go_terms": [
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005667",
"name": "transcription regulator complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0046983",
"name": "protein dimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000978",
"name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006357",
"name": "regulation of transcription by RNA polymerase II",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1301c612e09287c5a4a26dd779a5b1be31f57cfd",
"counters": {
"domain_architectures": 8515,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"smart": 1,
"cathgene3d": 2,
"ssf": 2,
"cdd": 1,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8515
}
}
}