General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A091PS84",
        "id": "A0A091PS84_HALAL",
        "source_organism": {
            "taxId": "8969",
            "scientificName": "Haliaeetus albicilla",
            "fullName": "Haliaeetus albicilla (White-tailed sea-eagle)"
        },
        "name": "Chloride intracellular channel protein",
        "description": [
            "In the soluble state, catalyzes glutaredoxin-like thiol disulfide exchange reactions with reduced glutathione as electron donor. Can insert into membranes and form voltage-dependent multi-ion conductive channels. Membrane insertion seems to be redox-regulated and may occur only under oxidizing conditions. Has alternate cellular functions like a potential role in angiogenesis or in maintaining apical-basolateral membrane polarity during mitosis and cytokinesis. Could also promote endothelial cell proliferation and regulate endothelial morphogenesis (tubulogenesis). Promotes cell-surface expression of HRH3"
        ],
        "length": 232,
        "sequence": "LLQAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITYNGEVKTDVNKIEEFLEDVLAPPKYLKLSPKHPESNTAGMDIFAKFSAFIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDITISTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFEIPKEMTGIWRYLTNAYSRDEFTNTCPGDKEIEIAYSDVAKRLTK",
        "proteome": null,
        "gene": "N329_08395",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6cae92723920465a0b88d6551dcf65ad4af8bf8b",
        "counters": {
            "domain_architectures": 2832,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 2,
                "cathgene3d": 2,
                "pfam": 1,
                "ssf": 2,
                "profile": 1,
                "panther": 1,
                "ncbifam": 1,
                "sfld": 2,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2832
        }
    }
}