GET /api/protein/UniProt/A0A091NJ64/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A091NJ64",
        "id": "A0A091NJ64_APAVI",
        "source_organism": {
            "taxId": "57397",
            "scientificName": "Apaloderma vittatum",
            "fullName": "Apaloderma vittatum (Bar-tailed trogon)"
        },
        "name": "Synaptotagmin",
        "description": [
            "May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone"
        ],
        "length": 420,
        "sequence": "ATTMPMTTMENSTEAAGPGESKEDMFTKLRDKFMNELNKIPLPPWALIAIAVVAGLLILTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKSGNQVMSFWSCPALGIVGRSLWLSYEPCQVTHCSGSREGWSHQDAGMGHRAISLRTPLSPLQLTVGILQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVQKKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQSGEKEEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVITVLDYDKLGKNEAIGKIFTGCNSTGTELRHWSDMLANPRRPIAQWHSLKPEEEVDAALGKNK",
        "proteome": "UP000054244",
        "gene": "N311_06915",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "76351f8e62ff50d525de723680d4da52aca317c5",
        "counters": {
            "domain_architectures": 34302,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 3,
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 34302
        }
    }
}