HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A091MZS8",
"id": "A0A091MZS8_APAVI",
"source_organism": {
"taxId": "57397",
"scientificName": "Apaloderma vittatum",
"fullName": "Apaloderma vittatum (Bar-tailed trogon)"
},
"name": "Protein Wnt",
"description": [
"Ligand for members of the frizzled family of seven transmembrane receptors that functions in the canonical Wnt/beta-catenin signaling pathway. Required for normal fusion of the chorion and the allantois during placenta development. Required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation"
],
"length": 325,
"sequence": "ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRYGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQEEGWKWGGCSADIRYGIEFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYILKEKYNAAVQVEVVRASRLRQPTFLKIKQIKSYQKPMETDLVYIEKSPNYCEEDASTGSVGTQGRLCNRTSPNADGCDMMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK",
"proteome": "UP000054244",
"gene": "N311_06536",
"go_terms": [
{
"identifier": "GO:0005102",
"name": "signaling receptor binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007275",
"name": "multicellular organism development",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016055",
"name": "Wnt signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3d8ab4a8c72a934a2cb4d67bef6e4e729ce824f1",
"counters": {
"domain_architectures": 52290,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"smart": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"prints": 2,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 52290
}
}
}