GET /api/protein/UniProt/A0A091GDQ2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A091GDQ2",
        "id": "A0A091GDQ2_CUCCA",
        "source_organism": {
            "taxId": "55661",
            "scientificName": "Cuculus canorus",
            "fullName": "Cuculus canorus (Common cuckoo)"
        },
        "name": "DNA topoisomerase I",
        "description": [
            "Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at the specific target site 5'-[CT]CCTTp site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(3'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 5'-OH DNA strand. The free DNA strand then undergoes passage around the unbroken strand thus removing DNA supercoils. Finally, in the religation step, the DNA 5'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone"
        ],
        "length": 583,
        "sequence": "KEKKPKGETKEKGKKSKRKSEEEIQGKTQKRKSKEEEEKNARKEGGGKKEEAGNKWKWWEEEKKEDGVKWTQLEHRGPYFAPLYEPLPDDVQFYYDGKPLKLSLATEEIATFYAKMLDHEYTTKEIFQNNFFNDWRKEMTSKEQKIIKDLDKCDFREIHKYFVDKNEARKALSKEEKQKLKEAADKIQEEYGYCILDGHREKIGNFKTEPPGLFRGRGDHPKMGMLKKRVMPEDIIINCSKDSKIPEPPEGHKWKEVRFDNTVTWLASWTENIQNSLKYIMLNPSSKLKGEKDWQKYEVARRLKDVVHKIRAQYRVDWKSKEMKKRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHIKLHPELDGQKHVVEFDFLGKDSIRYYNKVSVEKMVFKNLQVFMKNKDPTDDLFDRLNTSVVNKHLQSLMDGLTAKVFRTYNASITLQEQLKALTNSEDNVAGKLLSYNRANRAVAILCNHQRSTPKTFEKSMQNLQTKIDAKKQQVEEAQQELKKAEDEFEDSKDAKAEANVEKKKKLLKRLEEQLARLNVQATDKEENKQIALGTSKLNYLDPRISI",
        "proteome": "UP000053760",
        "gene": "N303_13874",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003917",
                "name": "DNA topoisomerase type I (single strand cut, ATP-independent) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006265",
                "name": "DNA topological change",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005694",
                "name": "chromosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fafe30359b70af3627e6396335bd964792b7f95d",
        "counters": {
            "domain_architectures": 6594,
            "entries": 31,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 3,
                "cathgene3d": 4,
                "cdd": 2,
                "smart": 1,
                "pfam": 3,
                "profile": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 14
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6594
        }
    }
}