GET /api/protein/UniProt/A0A091F9F1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A091F9F1",
"id": "A0A091F9F1_CORBR",
"source_organism": {
"taxId": "85066",
"scientificName": "Corvus brachyrhynchos",
"fullName": "Corvus brachyrhynchos (American crow)"
},
"name": "Mediator of RNA polymerase II transcription subunit 30",
"description": [
"Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors"
],
"length": 179,
"sequence": "MSTPPLAGAGMPPGAFSGTQAQAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTATYQDRLAKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPVPIEQLIPYVEEDGSKHDDRGAASQLRFASEERREIMEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN",
"proteome": "UP000052976",
"gene": "N302_07494",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8a87f9583140f5223a20b88d92ee3d45721f3e4d",
"counters": {
"domain_architectures": 1739,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1739
}
}
}