GET /api/protein/UniProt/A0A091DPT2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A091DPT2",
        "id": "A0A091DPT2_FUKDA",
        "source_organism": {
            "taxId": "885580",
            "scientificName": "Fukomys damarensis",
            "fullName": "Fukomys damarensis (Damaraland mole rat)"
        },
        "name": "Rab5 GDP/GTP exchange factor",
        "description": [
            "Rab effector protein acting as linker between gamma-adaptin, RAB4A or RAB5A. Involved in endocytic membrane fusion and membrane trafficking of recycling endosomes. Stimulates nucleotide exchange on RAB5A. Can act as a ubiquitin ligase"
        ],
        "length": 492,
        "sequence": "MSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYQKARQKQIQEDWELAERLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRVGSKKAEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKMFLETMHYKRELSIEEQSECTQDFYQSVAEKMQTRGKVPPEKVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALHWVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKLACITRCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEPESWSPDACLGVKQMYKNLDLLSQLNERQERIMSEAKKLEKDLIDWTDGIAKEVQDIVEKYPLEIKPTTQPLAAIDSENVENDKLPPPLQPQVYAG",
        "proteome": "UP000028990",
        "gene": "H920_05703",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005085",
                "name": "guanyl-nucleotide exchange factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016192",
                "name": "vesicle-mediated transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "39565ba6059f84a63395710e221e906ba466a560",
        "counters": {
            "domain_architectures": 1977,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "smart": 2,
                "ssf": 2,
                "cathgene3d": 3,
                "pfam": 3,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1977
        }
    }
}