HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A091DPT2",
"id": "A0A091DPT2_FUKDA",
"source_organism": {
"taxId": "885580",
"scientificName": "Fukomys damarensis",
"fullName": "Fukomys damarensis (Damaraland mole rat)"
},
"name": "Rab5 GDP/GTP exchange factor",
"description": [
"Rab effector protein acting as linker between gamma-adaptin, RAB4A or RAB5A. Involved in endocytic membrane fusion and membrane trafficking of recycling endosomes. Stimulates nucleotide exchange on RAB5A. Can act as a ubiquitin ligase"
],
"length": 492,
"sequence": "MSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYQKARQKQIQEDWELAERLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRVGSKKAEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKMFLETMHYKRELSIEEQSECTQDFYQSVAEKMQTRGKVPPEKVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALHWVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKLACITRCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEPESWSPDACLGVKQMYKNLDLLSQLNERQERIMSEAKKLEKDLIDWTDGIAKEVQDIVEKYPLEIKPTTQPLAAIDSENVENDKLPPPLQPQVYAG",
"proteome": "UP000028990",
"gene": "H920_05703",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005085",
"name": "guanyl-nucleotide exchange factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016192",
"name": "vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "39565ba6059f84a63395710e221e906ba466a560",
"counters": {
"domain_architectures": 1977,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 2,
"smart": 2,
"ssf": 2,
"cathgene3d": 3,
"pfam": 3,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1977
}
}
}