GET /api/protein/UniProt/A0A089Q0Q9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A089Q0Q9",
"id": "A0A089Q0Q9_9ENTR",
"source_organism": {
"taxId": "158822",
"scientificName": "Cedecea neteri",
"fullName": "Cedecea neteri"
},
"name": "Trp operon repressor",
"description": [
"This protein is an aporepressor. When complexed with L-tryptophan it binds the operator region of the trp operon (5'-ACTAGT-'3') and prevents the initiation of transcription. The complex also regulates trp repressor biosynthesis by binding to its regulatory region"
],
"length": 112,
"sequence": "MTQLSQYSAEQAEQSNKEWLRFVGLLQQAFGQDLHMPLLTLLLTPDERTALGTRVRIIEELLRGELSQRELKNELGAGIATITRGSNSLKAAPTELREWLEKELLQGGKPTR",
"proteome": "UP000029481",
"gene": "trpR",
"go_terms": [
{
"identifier": "GO:0043565",
"name": "sequence-specific DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "64b98b5f8c3c013da2f6d9e8f024243f0eb2375f",
"counters": {
"domain_architectures": 7100,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 1,
"pirsf": 1,
"hamap": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7100
}
}
}