General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A089Q0Q9",
        "id": "A0A089Q0Q9_9ENTR",
        "source_organism": {
            "taxId": "158822",
            "scientificName": "Cedecea neteri",
            "fullName": "Cedecea neteri"
        },
        "name": "Trp operon repressor",
        "description": [
            "This protein is an aporepressor. When complexed with L-tryptophan it binds the operator region of the trp operon (5'-ACTAGT-'3') and prevents the initiation of transcription. The complex also regulates trp repressor biosynthesis by binding to its regulatory region"
        ],
        "length": 112,
        "sequence": "MTQLSQYSAEQAEQSNKEWLRFVGLLQQAFGQDLHMPLLTLLLTPDERTALGTRVRIIEELLRGELSQRELKNELGAGIATITRGSNSLKAAPTELREWLEKELLQGGKPTR",
        "proteome": "UP000029481",
        "gene": "trpR",
        "go_terms": [
            {
                "identifier": "GO:0043565",
                "name": "sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "64b98b5f8c3c013da2f6d9e8f024243f0eb2375f",
        "counters": {
            "domain_architectures": 7100,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7100
        }
    }
}