General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A089PV57",
        "id": "A0A089PV57_9ENTR",
        "source_organism": {
            "taxId": "158822",
            "scientificName": "Cedecea neteri",
            "fullName": "Cedecea neteri"
        },
        "name": "7-methyl-GTP pyrophosphatase",
        "description": [
            "Nucleoside triphosphate pyrophosphatase that hydrolyzes 7-methyl-GTP (m(7)GTP). May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids"
        ],
        "length": 194,
        "sequence": "MKPIVLASTSPFRRSLLEKLGIPFITAAPEVDETPHQGEDARHLVTRLAQAKAQALKERYPHHLIIGSDQVCVLNNQIAGKPHSEENAVRQLMLARGTIVTFYTGLALYNSANGQLQTLCEPFDVHFRHLTEEEIRRYVQKEQPLNCAGSFKSEGLGITLFERLEGKDPNTLVGLPLISLCEMLRNEDCNPLLA",
        "proteome": "UP000029481",
        "gene": "JT31_04335",
        "go_terms": [
            {
                "identifier": "GO:0047429",
                "name": "nucleoside triphosphate diphosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4e50f860811e8bd429a94ec3d863c201dce946d0",
        "counters": {
            "domain_architectures": 36724,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "ncbifam": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 36724
        }
    }
}