GET /api/protein/UniProt/A0A087YMA2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A087YMA2",
"id": "A0A087YMA2_POEFO",
"source_organism": {
"taxId": "48698",
"scientificName": "Poecilia formosa",
"fullName": "Poecilia formosa (Amazon molly)"
},
"name": "Derlin",
"description": [
"Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by forming a channel that allows the retrotranslocation of misfolded proteins into the cytosol where they are ubiquitinated and degraded by the proteasome"
],
"length": 255,
"sequence": "MSDIGDWFRSIPLITRYWFAASIAVPFIGKLGLVDFRNLMLFPELVFSRFQQLWRPVTATLYFPVTPNTGFLYLVNLYFLYHYSTRLETGAFDGRPADYVFMLLFNWICIVITGLLMDMRLLMIPLIMSVLYVWAQFNSEMIVSFWFGTRFKAHYLPWVILVFNFIIGGSFMNELTGNLVGHLYFFLMFKYPMDLGGRSFLSTPDFLYRFFPNTRGGVSGFGVPPTRRPVPQEPPAAGGGGGRHNWGQGFRLGGE",
"proteome": "UP000028760",
"gene": null,
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5e289f64f63688d2c84bfacb1b0e28f6212c66ce",
"counters": {
"domain_architectures": 11300,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 11300
}
}
}