HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A087Y950",
"id": "A0A087Y950_POEFO",
"source_organism": {
"taxId": "48698",
"scientificName": "Poecilia formosa",
"fullName": "Poecilia formosa (Amazon molly)"
},
"name": "U3 small nucleolar RNA-associated protein 15 homolog",
"description": [
"Ribosome biogenesis factor. Involved in nucleolar processing of pre-18S ribosomal RNA. Required for optimal pre-ribosomal RNA transcription by RNA polymerase I. Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome"
],
"length": 535,
"sequence": "MASFKPTKIPVYPKLGEKVTQDTLYWKNYKAPVQIKEYGAVSNIDFSPVAPHNFAVTAFSRIHVYGPFSQEPVKTFTRFKDTAYCGRFRSDGQLLVAGCEDSVVRLFDVSGRVALRMFKGHTKAVHVTDFTSDRYQILTGSDDYTCRLWDIPNAAELSTYREHTDYIRCGVTSKLNRDLFITASGSYDHTLKVFDARAEKSVMTMDHGQPVESLLLYPSEGLLVSAGCGRYVKVWDLLKGGQPLVLLKNHHKTITCLALGSNGERLLSASLDRHVKVYNTTTYKVVHNFDYAAAILSLALAPDDESIVVGMTNSILSIKHRKHTEESKEMMSQQRRRPSYRVFVKGKNFVPKPDDYLVSKPVKEHLAKYDRELKKFNVSKALDASLEIWLRKKKPEITVGVIKELDRRGTLKNALAGRDEEQLSQLLHFVIGNIVDTRFAPIILTAAEMILDIYKSVIGQSALIDQQLLRLQNILESEINLEQELLEVLGMLDTMFATSVTRKEVPYSDVGRSNGLAQGEASSSRPELFRPPEIK",
"proteome": "UP000028760",
"gene": null,
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006364",
"name": "rRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005730",
"name": "nucleolus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b4dde1e724d75ee6014a35af66e6d4e5d4e1ebaf",
"counters": {
"domain_architectures": 801,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"cathgene3d": 1,
"ssf": 1,
"pfam": 2,
"cdd": 1,
"profile": 2,
"panther": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 801
}
}
}