HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A078S016",
"id": "A0A078S016_BACUN",
"source_organism": {
"taxId": "1339349",
"scientificName": "Bacteroides uniformis str. 3978 T3 ii",
"fullName": "Bacteroides uniformis str. 3978 T3 ii"
},
"name": "Meso-diaminopimelate D-dehydrogenase",
"description": [
"Catalyzes the reversible NADPH-dependent reductive amination of L-2-amino-6-oxopimelate, the acyclic form of L-tetrahydrodipicolinate, to generate the meso compound, D,L-2,6-diaminopimelate"
],
"length": 299,
"sequence": "MKKVRAAIVGYGNIGHYVLEALQAAPDFEIAGVVRRAGAENCPAELSAYPVVKNIKELKGVDVAILCTPTRKVEEYAKEILALGIHTVDSFDIHTGITALRRTLDAEAKKHNTVSIISAGWDPGSDSIVRTMLEAIAPKGITYTNFGPGMSMGHTVAVKAIEGVKAALSMTIPTGTGIHRRMVYIELKDGYEFDKVTAAIKADPYFVNDETHVKLVPSVDALLDMGHGVNLTRKGVSGKTQNQLFEFNMRINNPALTAQVLVCVARAAMRQQPGCYTMVEVPVIDLLPGDREEWIGHLV",
"proteome": null,
"gene": "M094_1740",
"go_terms": [
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0047850",
"name": "diaminopimelate dehydrogenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009089",
"name": "L-lysine biosynthetic process via diaminopimelate",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dc620f748561561970a7a2b6aff6b0034f4fccd6",
"counters": {
"domain_architectures": 640,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"pfam": 2,
"cdd": 1,
"panther": 1,
"pirsf": 1,
"ncbifam": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 640
}
}
}