GET /api/protein/UniProt/A0A077FGB3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A077FGB3",
"id": "A0A077FGB3_9PSED",
"source_organism": {
"taxId": "237609",
"scientificName": "Pseudomonas alkylphenolica",
"fullName": "Pseudomonas alkylphenolica"
},
"name": "Lipid A deacylase",
"description": [
"Has lipid A 3-O-deacylase activity. Hydrolyzes the ester bond at the 3 position of lipid A, a bioactive component of lipopolysaccharide (LPS), thereby releasing the primary fatty acyl moiety"
],
"length": 172,
"sequence": "MNTRLTLISVATLSLLSPLADAASITGAVGVTGQGDMTFRAGLEQAWDKSWWQTDTGHLSGYWDGAYTYWEGGDEASGAHSLSFSPVFIYEFSGWRYAPYIEVGVGVALFSKTDVGEQKLGSSFNFEDRIGVGLKLSDEQKVGIRAIHYSNAGIKQPNDGIESYSLFYTHSF",
"proteome": null,
"gene": "PSAKL28_30990",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "149666fb2e552414ff6870211454724664addbc2",
"counters": {
"domain_architectures": 6852,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 6852
}
}
}