General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A076YIQ8",
        "id": "A0A076YIQ8_9CAUD",
        "source_organism": {
            "taxId": "1527770",
            "scientificName": "Rhizobium phage vB_RleM_P10VF",
            "fullName": "Rhizobium phage vB_RleM_P10VF"
        },
        "name": "Head completion nuclease",
        "description": [
            "During phage morphogenesis, plays an essential role in the head-tail joining step. The associated nuclease activity is essential for morphogenesis, possibly by cleaving packaged DNA to enable the joining of heads to tails. Displays both exo- and endonuclease activity"
        ],
        "length": 153,
        "sequence": "MAGRNTYKSVFECKNPQKYAGDSKNIICRSSWERFFASNLDHNPNVVKWASEELAIPYVSPIDGKPHRYFVDFLVRFKNGDVVMVEIKPYGQTLPPAEPNKKSNKAMLRYRDEMSTYLINMAKWKAASEFCARNGMRFQVYTENELRSLGMPV",
        "proteome": "UP000204140",
        "gene": "P10VF_090",
        "go_terms": [
            {
                "identifier": "GO:0004519",
                "name": "endonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004527",
                "name": "exonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0090304",
                "name": "nucleic acid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "0c8faf6a236926cae3d12d3fd8fda260aa07ae69",
        "counters": {
            "domain_architectures": 2863,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2863
        }
    }
}