GET /api/protein/UniProt/A0A075I530/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A075I530",
        "id": "A0A075I530_9ARCH",
        "source_organism": {
            "taxId": "1456350",
            "scientificName": "uncultured marine thaumarchaeote KM3_97_B07",
            "fullName": "uncultured marine thaumarchaeote KM3_97_B07"
        },
        "name": "Archaetidylinositol phosphate synthase",
        "description": [
            "Catalyzes the formation of archaetidylinositol phosphate (AIP) from CDP-archaeol (CDP-ArOH or CDP-2,3-bis-(O-phytanyl)-sn-glycerol) and 1L-myo-inositol 1-phosphate (IP or 1D-myo-inositol 3-phosphate). AIP is a precursor of archaetidyl-myo-inositol (AI), an ether-type inositol phospholipid ubiquitously distributed in archaea membranes and essential for glycolipid biosynthesis in archaea"
        ],
        "length": 190,
        "sequence": "MLNNLRDSLQPHLEKIGKGFASTGISPNGWSCIGLVFAFASAFIYGWNVEFSLIIGGIILLVAGFFDIVDGQVARVSQKITKSGGFLDSVFDKIAEVAIFLGILVGGFAEPYLVFLAITFSLLVSYTRSRAESLGIKLQGIGIGERAERLLVIAIIGIIGFMEYAVIIVIIIAGITFIQRIVVTTKALRE",
        "proteome": null,
        "gene": "PGS1",
        "go_terms": [
            {
                "identifier": "GO:0016780",
                "name": "phosphotransferase activity, for other substituted phosphate groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008654",
                "name": "phospholipid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d6f44f91fd4815ce8d19cee6d0e80ac2449ec927",
        "counters": {
            "domain_architectures": 90890,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "hamap": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 90890
        }
    }
}