GET /api/protein/UniProt/A0A075I530/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A075I530",
"id": "A0A075I530_9ARCH",
"source_organism": {
"taxId": "1456350",
"scientificName": "uncultured marine thaumarchaeote KM3_97_B07",
"fullName": "uncultured marine thaumarchaeote KM3_97_B07"
},
"name": "Archaetidylinositol phosphate synthase",
"description": [
"Catalyzes the formation of archaetidylinositol phosphate (AIP) from CDP-archaeol (CDP-ArOH or CDP-2,3-bis-(O-phytanyl)-sn-glycerol) and 1L-myo-inositol 1-phosphate (IP or 1D-myo-inositol 3-phosphate). AIP is a precursor of archaetidyl-myo-inositol (AI), an ether-type inositol phospholipid ubiquitously distributed in archaea membranes and essential for glycolipid biosynthesis in archaea"
],
"length": 190,
"sequence": "MLNNLRDSLQPHLEKIGKGFASTGISPNGWSCIGLVFAFASAFIYGWNVEFSLIIGGIILLVAGFFDIVDGQVARVSQKITKSGGFLDSVFDKIAEVAIFLGILVGGFAEPYLVFLAITFSLLVSYTRSRAESLGIKLQGIGIGERAERLLVIAIIGIIGFMEYAVIIVIIIAGITFIQRIVVTTKALRE",
"proteome": null,
"gene": "PGS1",
"go_terms": [
{
"identifier": "GO:0016780",
"name": "phosphotransferase activity, for other substituted phosphate groups",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008654",
"name": "phospholipid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d6f44f91fd4815ce8d19cee6d0e80ac2449ec927",
"counters": {
"domain_architectures": 90890,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"hamap": 1,
"pfam": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 90890
}
}
}