GET /api/protein/UniProt/A0A075GA60/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A075GA60",
        "id": "A0A075GA60_9ARCH",
        "source_organism": {
            "taxId": "1456003",
            "scientificName": "uncultured marine thaumarchaeote KM3_135_A07",
            "fullName": "uncultured marine thaumarchaeote KM3_135_A07"
        },
        "name": "Phosphomevalonate dehydratase large subunit",
        "description": [
            "Component of a hydro-lyase that catalyzes the dehydration of mevalonate 5-phosphate (MVA5P) to form trans-anhydromevalonate 5-phosphate (tAHMP). Involved in the archaeal mevalonate (MVA) pathway, which provides fundamental precursors for isoprenoid biosynthesis, such as isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP)"
        ],
        "length": 305,
        "sequence": "MGYDKDSVEKFGLDENFIQKQESIRTSYKKMGVTPSFSCIPYEVYDMPQEGTQVAFAETNAAIYANSVGKLKTNKESAFSALASAITGKSPYSDLRKDDSPTMSIAMKVSEPNELTFGLLGYFAGKVADKSVAISGVKNLDKRCNKSLCASMGTSGTCGKFVLDDNSGATEKVDFDEKEMQKVYDELNTAESGDLITLGSPQLGLEEMNDLTSMLKGRAFKKRCLIFCPRPIQEQARHLGYAGQLESAGCELMSDCCTCLTPLVTKKDADSVTTNSIKGAYYLKNSNGLDVNLKPLSEIVRDETS",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "69cdaef196c59efe79dd99d719a1db559d793ce9",
        "counters": {
            "domain_architectures": 1592,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 3,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1592
        }
    }
}