GET /api/protein/UniProt/A0A075GA60/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A075GA60",
"id": "A0A075GA60_9ARCH",
"source_organism": {
"taxId": "1456003",
"scientificName": "uncultured marine thaumarchaeote KM3_135_A07",
"fullName": "uncultured marine thaumarchaeote KM3_135_A07"
},
"name": "Phosphomevalonate dehydratase large subunit",
"description": [
"Component of a hydro-lyase that catalyzes the dehydration of mevalonate 5-phosphate (MVA5P) to form trans-anhydromevalonate 5-phosphate (tAHMP). Involved in the archaeal mevalonate (MVA) pathway, which provides fundamental precursors for isoprenoid biosynthesis, such as isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP)"
],
"length": 305,
"sequence": "MGYDKDSVEKFGLDENFIQKQESIRTSYKKMGVTPSFSCIPYEVYDMPQEGTQVAFAETNAAIYANSVGKLKTNKESAFSALASAITGKSPYSDLRKDDSPTMSIAMKVSEPNELTFGLLGYFAGKVADKSVAISGVKNLDKRCNKSLCASMGTSGTCGKFVLDDNSGATEKVDFDEKEMQKVYDELNTAESGDLITLGSPQLGLEEMNDLTSMLKGRAFKKRCLIFCPRPIQEQARHLGYAGQLESAGCELMSDCCTCLTPLVTKKDADSVTTNSIKGAYYLKNSNGLDVNLKPLSEIVRDETS",
"proteome": null,
"gene": null,
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "69cdaef196c59efe79dd99d719a1db559d793ce9",
"counters": {
"domain_architectures": 1592,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 3,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1592
}
}
}