General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A074TGA7",
        "id": "A0A074TGA7_9RHOB",
        "source_organism": {
            "taxId": "1185766",
            "scientificName": "Thioclava dalianensis",
            "fullName": "Thioclava dalianensis"
        },
        "name": "Recombination protein RecR",
        "description": [
            "May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO"
        ],
        "length": 199,
        "sequence": "MTQGRDDIEGLIALMARLPGLGPRSARRAVLHLISKRGQLMAPLAEVMADVARNARECARCGNISGQPVCAICEDPKRATGEICVIEDVADLWAMERGHAFKGRYHVLGGTLSALDAIGPETLRIPDLLTRVESEGIGEVILALNATVEGQTTAHYIAEALEPMGVSVTSLAQGVPIGGELDYLDDGTIQAALRARKAF",
        "proteome": "UP000027725",
        "gene": "recR",
        "go_terms": [
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006310",
                "name": "DNA recombination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ce01ad59a6925878e860e8dcc06379ca41da7ed2",
        "counters": {
            "domain_architectures": 21330,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 1,
                "pfam": 4,
                "smart": 1,
                "profile": 1,
                "cdd": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21330
        }
    }
}