General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A072P2A6",
        "id": "A0A072P2A6_9EURO",
        "source_organism": {
            "taxId": "1182545",
            "scientificName": "Exophiala aquamarina CBS 119918",
            "fullName": "Exophiala aquamarina CBS 119918"
        },
        "name": "Ribosome biogenesis protein YTM1",
        "description": [
            "Component of the NOP7 complex, which is required for maturation of the 25S and 5.8S ribosomal RNAs and formation of the 60S ribosome"
        ],
        "length": 460,
        "sequence": "MASTLQDPSNALVRVRLTTRDADLTLNDTAPILVPTSFRRYPLSSLVNGLLEKEKPIPLEFIVNGTYLRTTLDEYLSTSGLSTETTLAVEYVRARIPPQYIASYEHEDWVSDVDAVSLNSSPRILSASYDGHLRVWNTSAQVLATSPGTRFGGHNSLIKSAKFVSPAQIVSGGFDRTVRLWKYSEEAEGFSASLIPSLELYGHKSSVDFVNAHEGSGRILSASSDHSVGFWSTRKSDAPAAPEELVPRSRGKDGKRRKLNPDVSLPQRGPVAMMQQHTGPVSAAIFDVNDATVGYSSSWDQTVRTWDLVTASLVDTRTTSGALFCVEHMPNLHLLAAGSVSRVIKLVDPRASATTVAAMTLKGHKNSVVSLARDPSNEYTLVSGSHDGTCRVWDVRSTQQEKEGLVGQSLYTLPRASLKGGPSPGAGDGVKVFGVCWHSDVGILSGGEDKVVQVNRGEKT",
        "proteome": "UP000027920",
        "gene": "YTM1",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042254",
                "name": "ribosome biogenesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0dca40cc0d7b38c26cf9c91e77a97c5b42c3acbf",
        "counters": {
            "domain_architectures": 898,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "smart": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "profile": 2,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 898
        }
    }
}