GET /api/protein/UniProt/A0A069CXM6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A069CXM6",
        "id": "A0A069CXM6_9BACE",
        "source_organism": {
            "taxId": "1121097",
            "scientificName": "Bacteroides graminisolvens DSM 19988 = JCM 15093",
            "fullName": "Bacteroides graminisolvens DSM 19988 = JCM 15093"
        },
        "name": "Adenosylcobinamide-GDP ribazoletransferase",
        "description": [
            "Joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). Also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate"
        ],
        "length": 252,
        "sequence": "MGYRILAAFIFFTRLPFWRLAQVPAECYKTVVNYWPLAGWLTGGVLASVLWLSAQILPYSVAVILALAGRLLLTGCLHEDGLADFFDGLGGGTSRERILAIMKDSFIGSYGVTGLVVYFALLFSLLHALPLPLACAAVLAGDPWGKFSAAQLVNFLPYARREEDSKAKVVYNKMSVGTFIFALLTGVLPAVLFLPYQYVAAALFSLLTIALLIVFLKRKLQGYTGDCCGAAFLLCELNFYLGINILYHYYVV",
        "proteome": "UP000027601",
        "gene": "cobS",
        "go_terms": [
            {
                "identifier": "GO:0008818",
                "name": "cobalamin 5'-phosphate synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051073",
                "name": "adenosylcobinamide-GDP ribazoletransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "273e5485534238ffd63b6cd13298072b219ea626",
        "counters": {
            "domain_architectures": 15762,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15762
        }
    }
}