GET /api/protein/UniProt/A0A067P2X5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A067P2X5",
        "id": "A0A067P2X5_PLEO1",
        "source_organism": {
            "taxId": "1137138",
            "scientificName": "Pleurotus ostreatus (strain PC15)",
            "fullName": "Pleurotus ostreatus (strain PC15) (Oyster mushroom)"
        },
        "name": "tRNA-splicing endonuclease subunit Sen34",
        "description": [
            "Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body"
        ],
        "length": 317,
        "sequence": "MTTDSRPIPIRIANQRAYIWDVDDIAVLRSQHRLCGILAGTLPHLSQQNVFLGIPLLLMPEEVVLLVEKSAQFAVLVDDRNAHQAPTAPQLQKWEEERDEFAKRHIVVNDTKISQNAATRSMSEDAMRKRKERMERKAAQPQQPPPVDMIPEESPAERTEATPTTDSRPSTPSSNAITVAYPVIIESASSTLEWYDTSAATYNTIEAAQAAGIWSYPSNLSERARCGVFRGLWEQGYFLGGGIKFGGDYLVYPGDPLRFHSHFVATVIESPVATLRPMEIVAHGRLGTATKKSHLLCGWNDEKKDVSYLSIEWAGFG",
        "proteome": null,
        "gene": "PLEOSDRAFT_1033239",
        "go_terms": [
            {
                "identifier": "GO:0000213",
                "name": "tRNA-intron lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006388",
                "name": "tRNA splicing, via endonucleolytic cleavage and ligation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000379",
                "name": "tRNA-type intron splice site recognition and cleavage",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000214",
                "name": "tRNA-intron endonuclease complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fa637732133755569cf5aabd1f4a5393f3315697",
        "counters": {
            "domain_architectures": 2587,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cdd": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2587
        }
    }
}