General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A067CB50",
        "id": "A0A067CB50_SAPPC",
        "source_organism": {
            "taxId": "695850",
            "scientificName": "Saprolegnia parasitica (strain CBS 223.65)",
            "fullName": "Saprolegnia parasitica (strain CBS 223.65)"
        },
        "name": "Elongator complex protein 3",
        "description": [
            "Catalytic tRNA acetyltransferase subunit of the elongator complex, which is required for multiple tRNA modifications, including mcm5U (5-methoxycarbonylmethyl uridine), mcm5s2U (5-methoxycarbonylmethyl-2-thiouridine), and ncm5U (5-carbamoylmethyl uridine). In the elongator complex, acts as a tRNA uridine(34) acetyltransferase by mediating formation of carboxymethyluridine in the wobble base at position 34 in tRNAs"
        ],
        "length": 559,
        "sequence": "MGLGLFHKKAHTPPAPITDDTDVMSSNAGVDSETYVKAISSIVEEIIKAYEKQEPVNMTRLKNDVAKGYRLPSMPKLVDIISAIPEEYKEELLPFLKAKPVRTASGIAVVAVMCKPHRCPHIAMTGNICVYCPGGPDSDFEYSTQAYTGYEPTSMRAIRARYNPYVQTKTRVDQLRRLGHNVDRCVEFIVMGGTFLSLDKEYRDYFIRNLHDALSGHTSASVAEACTAITIETRPDYCLKPHLNDMLAYGCTRIEIGVQSIYEDVARDSNRGHTVAAVCHSFQLAKDCGYKIVAHMMPDLPNMGMERDLNGFKEYFENPLFRTDGLKIYPTLVIRGTGLYELWKTGQYKNYSPNELVDLMARLLALVPPWTRVYRIQRDIPMPLVTSGVENGNLRELALARMKDLGLACRDVRTREVGMKGIHDQVAPDHVELIRRDYVANGGWETFLAYEDVDQDILVGLLRLRQASATAFRPEIPPGTSIVRELHVYGSAVPLHARDPTKFQHQGFGTLLMEEAERIARDEHGSHKIVVISGVGTRDYYRKLGYTLEGPYMVKDLEG",
        "proteome": "UP000030745",
        "gene": "SPRG_07312",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016747",
                "name": "acyltransferase activity, transferring groups other than amino-acyl groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8c84234cdf3d4b7b23897e9bb7b2f51bfa4beef6",
        "counters": {
            "domain_architectures": 2088,
            "entries": 26,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 4,
                "profile": 2,
                "smart": 1,
                "cdd": 1,
                "ssf": 2,
                "cathgene3d": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "sfld": 3,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2088
        }
    }
}