GET /api/protein/UniProt/A0A066UT84/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A066UT84",
"id": "A0A066UT84_9VIBR",
"source_organism": {
"taxId": "212667",
"scientificName": "Vibrio fortis",
"fullName": "Vibrio fortis"
},
"name": "Major outer membrane lipoprotein Lpp",
"description": [
"A highly abundant outer membrane lipoprotein that controls the distance between the inner and outer membranes. The only protein known to be covalently linked to the peptidoglycan network (PGN). Also non-covalently binds the PGN. The link between the cell outer membrane and PGN contributes to maintenance of the structural and functional integrity of the cell envelope, and maintains the correct distance between the PGN and the outer membrane"
],
"length": 88,
"sequence": "MNKVLIAAAASVFVLAGCSSDPEEAAMSEVEQLSNQVAQLSSEVEALKSEKADAEMKAQEATDAAMAAKEEAMRANERIDNIANSYTK",
"proteome": "UP000027219",
"gene": "lpp",
"go_terms": [
{
"identifier": "GO:0019867",
"name": "outer membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8e03bf20833efde8154c77a20aaf0224874a0ccf",
"counters": {
"domain_architectures": 2314,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"ssf": 1,
"cathgene3d": 1,
"pirsf": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2314
}
}
}