General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A063CUC3",
        "id": "A0A063CUC3_BACCE",
        "source_organism": {
            "taxId": "1396",
            "scientificName": "Bacillus cereus",
            "fullName": "Bacillus cereus"
        },
        "name": "Germination protein GerPF",
        "description": [
            "Required for the formation of functionally normal spores. Could be involved in the establishment of normal spore coat structure and/or permeability, which allows the access of germinants to their receptor"
        ],
        "length": 71,
        "sequence": "MPSVVGNLVVQNSNGSFNLGDFYNVSPKENTKAYNGSGASNVGFVVNTFNGVSATNTFDSDVADQDQIGTA",
        "proteome": null,
        "gene": "gerPF",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8388a85696df5788299f8fb842138050db7e62fa",
        "counters": {
            "domain_architectures": 3137,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3137
        }
    }
}