GET /api/protein/UniProt/A0A063CUC3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A063CUC3",
"id": "A0A063CUC3_BACCE",
"source_organism": {
"taxId": "1396",
"scientificName": "Bacillus cereus",
"fullName": "Bacillus cereus"
},
"name": "Germination protein GerPF",
"description": [
"Required for the formation of functionally normal spores. Could be involved in the establishment of normal spore coat structure and/or permeability, which allows the access of germinants to their receptor"
],
"length": 71,
"sequence": "MPSVVGNLVVQNSNGSFNLGDFYNVSPKENTKAYNGSGASNVGFVVNTFNGVSATNTFDSDVADQDQIGTA",
"proteome": null,
"gene": "gerPF",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8388a85696df5788299f8fb842138050db7e62fa",
"counters": {
"domain_architectures": 3137,
"entries": 3,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3137
}
}
}