GET /api/protein/UniProt/A0A062U7T0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A062U7T0",
        "id": "A0A062U7T0_9PROT",
        "source_organism": {
            "taxId": "1280946",
            "scientificName": "Hyphomonas beringensis",
            "fullName": "Hyphomonas beringensis"
        },
        "name": "Epoxyqueuosine reductase",
        "description": [
            "Catalyzes the conversion of epoxyqueuosine (oQ) to queuosine (Q), which is a hypermodified base found in the wobble positions of tRNA(Asp), tRNA(Asn), tRNA(His) and tRNA(Tyr)"
        ],
        "length": 370,
        "sequence": "MPDPLHILVKDLARSLGFDAVAITRADEPWQAGERLEAFVDAGHHGSMEWMETTLERRKAPTAMWADAKSAVVVALNYGPDHDPLLTLQHKTVGNISVYARGKDYHDTLKKRLKQLAREFVDESGAEVKVFVDTAPLMEKPLAHKAGLGWQGKHTNLVSRELGSWFFLGVMLTAAELEPDTPETDHCGSCRACQDICPTNAFPAPYTLDARRCISYLTIEHAGPIPQEFRAAMGNRIYGCDDCLAICPWNKFAGAANEAAFHARAELKVPGLDELAALDDQGFRDVFSGSPIKRIGRDRFVRNVCIAIGNSGEAQLISSLLPLLQDDVPVVRGAAVWALGRLDAARFAEQKAALMDRETDPDVLAEWMMD",
        "proteome": "UP000027037",
        "gene": "queG",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008033",
                "name": "tRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008616",
                "name": "tRNA queuosine(34) biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cd4ed3d90240ab5b8fd8c6bb6a1b5dd59f312d4e",
        "counters": {
            "domain_architectures": 2746,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "profile": 1,
                "cathgene3d": 2,
                "pfam": 3,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2746
        }
    }
}