HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A062U7T0",
"id": "A0A062U7T0_9PROT",
"source_organism": {
"taxId": "1280946",
"scientificName": "Hyphomonas beringensis",
"fullName": "Hyphomonas beringensis"
},
"name": "Epoxyqueuosine reductase",
"description": [
"Catalyzes the conversion of epoxyqueuosine (oQ) to queuosine (Q), which is a hypermodified base found in the wobble positions of tRNA(Asp), tRNA(Asn), tRNA(His) and tRNA(Tyr)"
],
"length": 370,
"sequence": "MPDPLHILVKDLARSLGFDAVAITRADEPWQAGERLEAFVDAGHHGSMEWMETTLERRKAPTAMWADAKSAVVVALNYGPDHDPLLTLQHKTVGNISVYARGKDYHDTLKKRLKQLAREFVDESGAEVKVFVDTAPLMEKPLAHKAGLGWQGKHTNLVSRELGSWFFLGVMLTAAELEPDTPETDHCGSCRACQDICPTNAFPAPYTLDARRCISYLTIEHAGPIPQEFRAAMGNRIYGCDDCLAICPWNKFAGAANEAAFHARAELKVPGLDELAALDDQGFRDVFSGSPIKRIGRDRFVRNVCIAIGNSGEAQLISSLLPLLQDDVPVVRGAAVWALGRLDAARFAEQKAALMDRETDPDVLAEWMMD",
"proteome": "UP000027037",
"gene": "queG",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008033",
"name": "tRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008616",
"name": "tRNA queuosine(34) biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cd4ed3d90240ab5b8fd8c6bb6a1b5dd59f312d4e",
"counters": {
"domain_architectures": 2746,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"profile": 1,
"cathgene3d": 2,
"pfam": 3,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2746
}
}
}