GET /api/protein/UniProt/A0A062ICX1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A062ICX1",
"id": "A0A062ICX1_ACIBA",
"source_organism": {
"taxId": "1310697",
"scientificName": "Acinetobacter baumannii 21072",
"fullName": "Acinetobacter baumannii 21072"
},
"name": "Hypoxanthine phosphoribosyltransferase",
"description": [
"Purine salvage pathway enzyme which catalyzes the transfer of the ribosyl-5-phosphate group from 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to the N9 position of hypoxanthine to yield IMP (inosine 5'-monophosphate). To a lesser extent, can also act on guanine leading to GMP, but shows a highly less efficient activity with xanthine"
],
"length": 175,
"sequence": "MTVAMSIMISTEEIQAKVKELGEQINSHYANSDKELVLIGLLRGSVIFMADLCRTITKPHELDFMTVSSYGGGTTSSRDVKILKDLDGEIRGKDVLVVEDIIDSGNTLSKVVEMLQTREPNSIQLCTLVSKPSRREIDLEVKFLGFEVEDKFIVGYGLDYDQKYRHLPFIGEIGL",
"proteome": null,
"gene": "hpt",
"go_terms": [
{
"identifier": "GO:0004422",
"name": "hypoxanthine phosphoribosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006166",
"name": "purine ribonucleoside salvage",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0f8ac38f062a402c09070bf5cbec330fb03fbefd",
"counters": {
"domain_architectures": 136430,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 136430
}
}
}