GET /api/protein/UniProt/A0A061IGF3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A061IGF3",
"id": "A0A061IGF3_CRIGR",
"source_organism": {
"taxId": "10029",
"scientificName": "Cricetulus griseus",
"fullName": "Cricetulus griseus (Chinese hamster)"
},
"name": "Hyaluronan and proteoglycan link protein 1",
"description": [
"Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix"
],
"length": 354,
"sequence": "MKSLLLLVLFSVCWADHLSDSYTPDQDRVIHIQAENGPRLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLREVDVFVSMGYHKKTYGGYQGRVFLKGGSDNDASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALELQGVVFPYFPRLGRYNLNFHEARQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKLLGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN",
"proteome": "UP001108280",
"gene": "Hapln1",
"go_terms": [
{
"identifier": "GO:0005540",
"name": "hyaluronic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007155",
"name": "cell adhesion",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "155a6f2af894beb143468523a189c467075d2d7f",
"counters": {
"domain_architectures": 3866,
"entries": 26,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 2,
"cathgene3d": 2,
"cdd": 3,
"smart": 3,
"pfam": 2,
"ssf": 2,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 9
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3866
}
}
}