GET /api/protein/UniProt/A0A061CZX9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A061CZX9",
        "id": "A0A061CZX9_ECTOL",
        "source_organism": {
            "taxId": "301",
            "scientificName": "Ectopseudomonas oleovorans",
            "fullName": "Ectopseudomonas oleovorans"
        },
        "name": "Aminodeoxychorismate lyase",
        "description": [
            "Involved in the biosynthesis of p-aminobenzoate (PABA), a precursor of tetrahydrofolate. Converts 4-amino-4-deoxychorismate into 4-aminobenzoate (PABA) and pyruvate"
        ],
        "length": 271,
        "sequence": "MLSWVNGAPGEQLSVRDRGLAYGDGLFETIAVRGGRIPLLARHMARLADGCRRLSIPLDLVLIEHELQAFAGLLGEGVAKLIVSRGEGQRGYAPPQPCQPLRILQAAPLPQYPAAHAEQGVRLFPCETRLAEQPLLAGLKHLNRLEQVLARAEWQDPECAEGLMRDSSGRVIEGVYSNLFLVVDGGLVSAQLSRCGVAGVMRAEILQQAQLLGLSVELRDVSFDELLDADEVFLCNSLYGIWPVRALQERHWSVGPLTRKLQAIVCDLLSN",
        "proteome": null,
        "gene": "pabC",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008696",
                "name": "4-amino-4-deoxychorismate lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030170",
                "name": "pyridoxal phosphate binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046656",
                "name": "folic acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9c8cf9b0777e925f72b88b5d6f7ebb434bd00bc5",
        "counters": {
            "domain_architectures": 76076,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 2,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 76076
        }
    }
}