HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A061CZX9",
"id": "A0A061CZX9_ECTOL",
"source_organism": {
"taxId": "301",
"scientificName": "Ectopseudomonas oleovorans",
"fullName": "Ectopseudomonas oleovorans"
},
"name": "Aminodeoxychorismate lyase",
"description": [
"Involved in the biosynthesis of p-aminobenzoate (PABA), a precursor of tetrahydrofolate. Converts 4-amino-4-deoxychorismate into 4-aminobenzoate (PABA) and pyruvate"
],
"length": 271,
"sequence": "MLSWVNGAPGEQLSVRDRGLAYGDGLFETIAVRGGRIPLLARHMARLADGCRRLSIPLDLVLIEHELQAFAGLLGEGVAKLIVSRGEGQRGYAPPQPCQPLRILQAAPLPQYPAAHAEQGVRLFPCETRLAEQPLLAGLKHLNRLEQVLARAEWQDPECAEGLMRDSSGRVIEGVYSNLFLVVDGGLVSAQLSRCGVAGVMRAEILQQAQLLGLSVELRDVSFDELLDADEVFLCNSLYGIWPVRALQERHWSVGPLTRKLQAIVCDLLSN",
"proteome": null,
"gene": "pabC",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008696",
"name": "4-amino-4-deoxychorismate lyase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030170",
"name": "pyridoxal phosphate binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046656",
"name": "folic acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9c8cf9b0777e925f72b88b5d6f7ebb434bd00bc5",
"counters": {
"domain_architectures": 76076,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"ncbifam": 2,
"panther": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 76076
}
}
}