GET /api/protein/UniProt/A0A060XUZ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A060XUZ5",
        "id": "A0A060XUZ5_ONCMY",
        "source_organism": {
            "taxId": "8022",
            "scientificName": "Oncorhynchus mykiss",
            "fullName": "Oncorhynchus mykiss (Rainbow trout)"
        },
        "name": "RING-type domain-containing protein",
        "description": [
            "Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of rnf2"
        ],
        "length": 328,
        "sequence": "MTMHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKMCIVRYLETSKYCPICDVPVHKTKPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSVDATTRSNEDRGEVADEDKRIITDDEIISLSIEFFDNNKAKKTGVAEDKQSKEQVNNKRYLQCPAAMTIMHLRKFLRSKMDIPCTYQVEVMYEDEPLKDYYTLMDVAYIYTWRRNGPLPLKYRVRPSCKKLKMSHPQQEGQNSTGRSAESDSASDKACSPAGVPSTSSLPSPGTPVQSPHLPHISKPVNGASASAPAPTRPFPFGNKPRKASLNGSSLSSGLA",
        "proteome": null,
        "gene": "GSONMT00023734001",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5be2b93f74851266da258b611f3d2a929a6fd262",
        "counters": {
            "domain_architectures": 7472,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 2,
                "ssf": 1,
                "pfam": 2,
                "smart": 1,
                "profile": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 7472
        }
    }
}