General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A060SL12",
        "id": "A0A060SL12_PYCCI",
        "source_organism": {
            "taxId": "5643",
            "scientificName": "Pycnoporus cinnabarinus",
            "fullName": "Pycnoporus cinnabarinus (Cinnabar-red polypore)"
        },
        "name": "Cytochrome b-c1 complex subunit 8",
        "description": [
            "Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The complex plays an important role in the uptake of multiple carbon sources present in different host niches"
        ],
        "length": 101,
        "sequence": "MRPTEIRHSEMPGPKVYNLWWGDKGVQKQKGIVTYSLSPFRQRAAHKMITNWIFNGYRRLSSQAVYWVIPFALGYGTYSWAKRYDAWQNSKAAHVAGHHEH",
        "proteome": "UP000029665",
        "gene": "BN946_scf185010.g15",
        "go_terms": [
            {
                "identifier": "GO:0006122",
                "name": "mitochondrial electron transport, ubiquinol to cytochrome c",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045275",
                "name": "respiratory chain complex III",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9f40e9dec049e1a8dfafddc21aa8555647e7b8a4",
        "counters": {
            "domain_architectures": 3149,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3149
        }
    }
}