GET /api/protein/UniProt/A0A060IHA9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A060IHA9",
        "id": "A0A060IHA9_RHIET",
        "source_organism": {
            "taxId": "1432050",
            "scientificName": "Rhizobium etli bv. mimosae str. IE4771",
            "fullName": "Rhizobium etli bv. mimosae str. IE4771"
        },
        "name": "nitrile hydratase",
        "description": [
            "NHase catalyzes the hydration of various nitrile compounds to the corresponding amides"
        ],
        "length": 247,
        "sequence": "MKLQHYLGGLEGLGPVSTETRVFVDVWETRIFGIHAAMMALSPQLPLPETPSTFKTIWTWADLRKGAESLNPFDYFRFRYYEKWLGGISGYFIYNGYITAEELDALTEEYYNEPSKPLHEAGDEAIDRRVVQYLIEGDSPKRDVGVTFEFKVGDTVAIRDVPTVEHTRLPGFLRNKLGTIETVYDGAYTYLCDTGPDGVGAAMPVYCVRFEPSDLWPDNAEKNFSLYADLYARYVEAPETAEASKAA",
        "proteome": null,
        "gene": "IE4771_PE00114",
        "go_terms": [
            {
                "identifier": "GO:0018822",
                "name": "nitrile hydratase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046914",
                "name": "transition metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "325d3bfd72d9495239d66155449f937fd2a41f40",
        "counters": {
            "domain_architectures": 2222,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 2,
                "ssf": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2222
        }
    }
}