HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A058ZRI7",
"id": "A0A058ZRI7_9RHOB",
"source_organism": {
"taxId": "1461693",
"scientificName": "Actibacterium atlanticum",
"fullName": "Actibacterium atlanticum"
},
"name": "Bifunctional NAD(P)H-hydrate repair enzyme",
"description": [
"Bifunctional enzyme that catalyzes the epimerization of the S- and R-forms of NAD(P)HX and the dehydration of the S-form of NAD(P)HX at the expense of ADP, which is converted to AMP. This allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration",
"Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ADP, which is converted to AMP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration",
"Catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. This is a prerequisite for the S-specific NAD(P)H-hydrate dehydratase to allow the repair of both epimers of NAD(P)HX"
],
"length": 550,
"sequence": "MGQSLMVELLTSAQMRAIENAAIANKTVTGLELMERAGRGVVDAIFAEWPELQAAPHRAVVLCGPGNNGGDGFVIARLLKDWGWEVEVFLYGDPAKLPPDAKTNYERWCEMGGVRSELPSDLGSKPAVVVDAMFGTGVTRPLTEPSDLYWAVYERWAVSNRSVHPFSDPVWVAVDIPSGLCSDSGKELEEDVLDGGALHVPAHLTVSFHRAKIGHHIANGPLVCGKTVVADIGLEGCSGPLEDAKHPPEGADGCCPAVSPSEIVHLAGAPRDLGKEVADHKYSNGHALVLSGGEGKSGAARLAARGALRVGAGLVTVGAPPSGMAECAAQLTAIMLKQIRDSKDLQDVLEDKRLNALCMGPGMGVGRNTREMVLAALASEYPRGVVLDADALTSFADDPAELFAALHHTCVLTPHGGEFARLFPDIAEALNATPTKGPAYSKVDATRAAAKRAGCVVLFKGPDTVIASPDGRCALNSAAYGRAAPWLATAGSGDVLAGIITGLMARGVSAQSAAEAGAWLHVEAARKFGPGLIAEDLPEQIPAVFRDLGA",
"proteome": "UP000024836",
"gene": "nnrE",
"go_terms": [
{
"identifier": "GO:0016836",
"name": "hydro-lyase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0052855",
"name": "ADP-dependent NAD(P)H-hydrate dehydratase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2d3cc4a65e0d282cab6625d9174661852f47cd75",
"counters": {
"domain_architectures": 19697,
"entries": 22,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"profile": 2,
"pfam": 2,
"cdd": 1,
"pirsf": 1,
"hamap": 2,
"ncbifam": 2,
"panther": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 19697
}
}
}