GET /api/protein/UniProt/A0A031LMF4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A031LMF4",
        "id": "A0A031LMF4_9CREN",
        "source_organism": {
            "taxId": "1160895",
            "scientificName": "Candidatus Acidianus copahuensis",
            "fullName": "Candidatus Acidianus copahuensis"
        },
        "name": "Fructose-1,6-bisphosphate aldolase/phosphatase",
        "description": [
            "Catalyzes two subsequent steps in gluconeogenesis: the aldol condensation of dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3-phosphate (GA3P) to fructose-1,6-bisphosphate (FBP), and the dephosphorylation of FBP to fructose-6-phosphate (F6P)"
        ],
        "length": 383,
        "sequence": "MKTTISVIKADIGSIAGHHVVHPDTMAAANKVLAQAKKDGIIIDYYITNVGDDMELIMTHTRGELDEKVHGTAWEAFKEATKVSKELGLYAAGQDLLSDTFSGNLKGMGPGIAEMEIEERPSEPFVVYMADKTEPGAFNFPQYKMFVDPFNTPGLVIDPTMHEGFKLEILDVYEGESVTLNAPEEIYDILALIGTPSRYVIRRIYRKADGNIGTVTSIERLNLIAGKYVGKDDPVLIVRVQHGFPALGETLEAFSFPYLVPGWMRGSHYGPLMPVSQRDARATRFDGPPRLIGLGFNVKNGKLAGPSDLFDDPAFDETRRLASQIADYMRRHGPFMPHRLEPTEMEYTTLPLVLEKLKPRFKKEEGMVKAKQSIYQKESSEMD",
        "proteome": "UP000024332",
        "gene": "fbp",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3d7f8219f5f7ca119d80986a2c3af3bfc3761318",
        "counters": {
            "domain_architectures": 939,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "hamap": 1,
                "pirsf": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 939
        }
    }
}