GET /api/protein/UniProt/A0A031LMF4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A031LMF4",
"id": "A0A031LMF4_9CREN",
"source_organism": {
"taxId": "1160895",
"scientificName": "Candidatus Acidianus copahuensis",
"fullName": "Candidatus Acidianus copahuensis"
},
"name": "Fructose-1,6-bisphosphate aldolase/phosphatase",
"description": [
"Catalyzes two subsequent steps in gluconeogenesis: the aldol condensation of dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3-phosphate (GA3P) to fructose-1,6-bisphosphate (FBP), and the dephosphorylation of FBP to fructose-6-phosphate (F6P)"
],
"length": 383,
"sequence": "MKTTISVIKADIGSIAGHHVVHPDTMAAANKVLAQAKKDGIIIDYYITNVGDDMELIMTHTRGELDEKVHGTAWEAFKEATKVSKELGLYAAGQDLLSDTFSGNLKGMGPGIAEMEIEERPSEPFVVYMADKTEPGAFNFPQYKMFVDPFNTPGLVIDPTMHEGFKLEILDVYEGESVTLNAPEEIYDILALIGTPSRYVIRRIYRKADGNIGTVTSIERLNLIAGKYVGKDDPVLIVRVQHGFPALGETLEAFSFPYLVPGWMRGSHYGPLMPVSQRDARATRFDGPPRLIGLGFNVKNGKLAGPSDLFDDPAFDETRRLASQIADYMRRHGPFMPHRLEPTEMEYTTLPLVLEKLKPRFKKEEGMVKAKQSIYQKESSEMD",
"proteome": "UP000024332",
"gene": "fbp",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3d7f8219f5f7ca119d80986a2c3af3bfc3761318",
"counters": {
"domain_architectures": 939,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"hamap": 1,
"pirsf": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 939
}
}
}