GET /api/protein/UniProt/A0A026WYP3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A026WYP3",
        "id": "A0A026WYP3_OOCBI",
        "source_organism": {
            "taxId": "2015173",
            "scientificName": "Ooceraea biroi",
            "fullName": "Ooceraea biroi (Clonal raider ant)"
        },
        "name": "5'-AMP-activated protein kinase subunit beta-1",
        "description": [
            "Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3)"
        ],
        "length": 283,
        "sequence": "MGNAGSNQPVSHHHGSSVRDREHRHSKDHPPPSPGKEGQAFVFDKKPSQKLVFQSSHEEEESYFTKNSQQDGEDFGSQRPRSNTVSEGTKVTDSKVLPTVFKWEGGGKQVFISGTFTGWKTLPMVKSHGDFVTIIDLPEGEHQYKFFVDGEWRHDPGLKIVDNGMGSKNNLVSVRKSDFEVFQALAKDSEGVTNSAQTEYGQEIPPHKPWEKVAGPPILPPHLLQVILNKDTPLSCEPTLLPEPNHVMLNHLYALSIKDSVMVLSATHRYRKKYVTTLLYKPI",
        "proteome": "UP000053097",
        "gene": "X777_08372",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "850be910b9cd318f3ca2b561f721d758cdaf390e",
        "counters": {
            "domain_architectures": 6674,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "pfam": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6674
        }
    }
}