GET /api/protein/UniProt/A0A026WYP3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A026WYP3",
"id": "A0A026WYP3_OOCBI",
"source_organism": {
"taxId": "2015173",
"scientificName": "Ooceraea biroi",
"fullName": "Ooceraea biroi (Clonal raider ant)"
},
"name": "5'-AMP-activated protein kinase subunit beta-1",
"description": [
"Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3)"
],
"length": 283,
"sequence": "MGNAGSNQPVSHHHGSSVRDREHRHSKDHPPPSPGKEGQAFVFDKKPSQKLVFQSSHEEEESYFTKNSQQDGEDFGSQRPRSNTVSEGTKVTDSKVLPTVFKWEGGGKQVFISGTFTGWKTLPMVKSHGDFVTIIDLPEGEHQYKFFVDGEWRHDPGLKIVDNGMGSKNNLVSVRKSDFEVFQALAKDSEGVTNSAQTEYGQEIPPHKPWEKVAGPPILPPHLLQVILNKDTPLSCEPTLLPEPNHVMLNHLYALSIKDSVMVLSATHRYRKKYVTTLLYKPI",
"proteome": "UP000053097",
"gene": "X777_08372",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "850be910b9cd318f3ca2b561f721d758cdaf390e",
"counters": {
"domain_architectures": 6674,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"cdd": 1,
"smart": 1,
"panther": 1,
"pfam": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6674
}
}
}