HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A026W3A1",
"id": "A0A026W3A1_OOCBI",
"source_organism": {
"taxId": "2015173",
"scientificName": "Ooceraea biroi",
"fullName": "Ooceraea biroi (Clonal raider ant)"
},
"name": "Ubiquitin carboxyl-terminal hydrolase",
"description": [
"Catalytic component of the polycomb repressive deubiquitinase (PR-DUB) complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK118ub1). Mediates bisymmetric organization of the PR-DUB complex and is involved in association with nucleosomes to mediate deubiquitination. Does not deubiquitinate monoubiquitinated histone H2B. Required to maintain the transcriptionally repressive state of homeotic genes throughout development. The PR-DUB complex has weak or no activity toward 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. Polycomb group (PcG) protein"
],
"length": 311,
"sequence": "MADSAGNWCLIESDPGVFTELIKEFGVKGAQVEELWSLDDEQFDDLKPIHGLIFLFKWVQDDELSGNIVQDSRLDKIFFAKQVINNACATQAILSVLLNCKHADISLGPNLEEFKNFCQSFDANMRGLALSNSDIIREVHNSFSRQTVFEYDSRQASKDDDVFHFVSYVPIDGRLYELDGLKDGPIDLGPCPVGEQWVQAAKPIIQKRINKYNEGEIHFNLMAIVTDRKTLYERQKANVCDPAELERLQTLIEEEIRKSKRYQIENIRRKHNYLPLIMELLKILAKEGKLVPLYQKAKEKALEKESKKNKV",
"proteome": "UP000053097",
"gene": "DMN91_003649",
"go_terms": [
{
"identifier": "GO:0004843",
"name": "cysteine-type deubiquitinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006511",
"name": "ubiquitin-dependent protein catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016579",
"name": "protein deubiquitination",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8ee7d6d4c7be4bc8b88c097d3270df4c9225d658",
"counters": {
"domain_architectures": 5948,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 2,
"pfam": 2,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5948
}
}
}