General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A024GLW7",
        "id": "A0A024GLW7_9STRA",
        "source_organism": {
            "taxId": "65357",
            "scientificName": "Albugo candida",
            "fullName": "Albugo candida"
        },
        "name": "Mediator of RNA polymerase II transcription subunit 10",
        "description": [
            "Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors"
        ],
        "length": 268,
        "sequence": "MNMEEEKEMMEIGEEKQHFFSDLQGPSIEEDNEEDAEMGTLEINPSLELVEGNMSEIAPSQSALSGADTEQERHAQVSASPYLAPFTPLSSPNNPKTPLTSTSSGRLSGIARKPQLIPIQESGQKSKAAGDSTVQGNNNSSNRVLCSSDGMDHLPVELVDSLMSTIQTLDKMILIVEDFKPNQLDFLCGKANEYIDLLKQVDAAASKYDVEIPVEVLEMLDAETDTNPELYTKKQLEKCQEESQFAAGKMESLRSLQRILENAFETLT",
        "proteome": "UP000053237",
        "gene": "MED10",
        "go_terms": [
            {
                "identifier": "GO:0003712",
                "name": "transcription coregulator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006357",
                "name": "regulation of transcription by RNA polymerase II",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016592",
                "name": "mediator complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "73eaa37955c08ba972ca6d35efef10f8a672c539",
        "counters": {
            "domain_architectures": 4019,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4019
        }
    }
}