HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A022WFS7",
"id": "A0A022WFS7_TRIRU",
"source_organism": {
"taxId": "1215330",
"scientificName": "Trichophyton rubrum CBS 288.86",
"fullName": "Trichophyton rubrum CBS 288.86"
},
"name": "Ceramide very long chain fatty acid hydroxylase",
"description": [
"Ceramide hydroxylase involved in the hydroxylation of sphingolipid-associated very long chain fatty acids. Postulated to hydroxylate the very long chain fatty acid of dihydroceramides and phytoceramides at C-2"
],
"length": 372,
"sequence": "MMPARTLPIFTAEEIKQHTSAKSCYVLRGPKVYDVTSFVDDHPGGGDLILDYAGKDVDEIMGDIVSHHHSEAAYEILDECLVGFLEKSHANGSKGLLNGSGAKLTKPVYKSTGLSSEEDLSVETDIVSDYKTHKFLDLSKPLLMQLWNGGFSKKFYLDQVHRPRHYMGGDSAPLFGNFLEPLSKTAWWVVPTLWLPCVAYGTFLGMSGIAVGTGALYWIGGLFLWSLIEYGMHRCLFHIDDYLPDNRVALCLHFLLHGIHHYLPMDKYRLVMPPTLFMVLATPYWKVAHFVFSYNWYAATLVFSGGVFGYICYDLTHYFLHHRNLPYYYKELKKYHLQHHFADYENGFGVTSRFWDKVFGTELPPLAPAKIE",
"proteome": null,
"gene": "H103_00479",
"go_terms": [
{
"identifier": "GO:0080132",
"name": "fatty acid 2-hydroxylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006629",
"name": "lipid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0020037",
"name": "heme binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "faf9dfd77227c1503d99ec3cf0179d773761d840",
"counters": {
"domain_architectures": 2806,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"smart": 1,
"pfam": 2,
"pirsf": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 2806
}
}
}