HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A022QWR8",
"id": "A0A022QWR8_ERYGU",
"source_organism": {
"taxId": "4155",
"scientificName": "Erythranthe guttata",
"fullName": "Erythranthe guttata (Yellow monkey flower)"
},
"name": "Uncharacterized protein",
"description": null,
"length": 252,
"sequence": "MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFASTSTAETLERYQRCSFNPQETNAERETQSWYQEVSKLKAKYESLQRTQRHLLGEDLGPLSIKELQNLEKQLELALVQARQRKTQLMMEQMEDLRRKERQLGDMNKQLKIRVSLEMSTLEAEGQGMRGLPCPWNSGESAAGGGGFHLQLPPSQQVDTIEPQPVLQMGYHDYDIGEGSSAPRSMDLDNNFFQAWTL",
"proteome": "UP000030748",
"gene": "MIMGU_mgv1a012364mg",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046983",
"name": "protein dimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000977",
"name": "RNA polymerase II transcription regulatory region sequence-specific DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045944",
"name": "positive regulation of transcription by RNA polymerase II",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "147d9c25ec6bd472e0fad0821e87714677aaf04e",
"counters": {
"domain_architectures": 22750,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"profile": 2,
"cdd": 1,
"ssf": 1,
"pfam": 2,
"cathgene3d": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 22750
}
}
}