General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A022PQ52",
        "id": "A0A022PQ52_ERYGU",
        "source_organism": {
            "taxId": "4155",
            "scientificName": "Erythranthe guttata",
            "fullName": "Erythranthe guttata (Yellow monkey flower)"
        },
        "name": "SKP1-like protein",
        "description": [
            "Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends on the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1"
        ],
        "length": 170,
        "sequence": "MSSSTAENGGKKITLRSSDGEVFEVEDAVAVESQTIKHMIEDDCADNVIPLPNVTGKILSKVIEYCKRHVDAAASATKADDKLASAAASDEDLKVFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE",
        "proteome": "UP000030748",
        "gene": "MIMGU_mgv1a015014mg",
        "go_terms": [
            {
                "identifier": "GO:0006511",
                "name": "ubiquitin-dependent protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3199382cafd42d17192238da0f86c9cfb0634da5",
        "counters": {
            "domain_architectures": 10809,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 1,
                "pfam": 2,
                "ssf": 2,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10809
        }
    }
}