General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A017S093",
        "id": "A0A017S093_ASPRC",
        "source_organism": {
            "taxId": "1388766",
            "scientificName": "Aspergillus ruber (strain CBS 135680)",
            "fullName": "Aspergillus ruber (strain CBS 135680)"
        },
        "name": "mRNA stability protein",
        "description": [
            "Plays an essential role in initiation of the G0 program by preventing the degradation of specific nutrient-regulated mRNAs via the 5'-3' mRNA decay pathway"
        ],
        "length": 103,
        "sequence": "QVLTDMWKERKYFDSGDYALSAANRATDNSAIQTGTARPLRKRISHPYDSVLNTSNANNDANKDLLIERNLGPEMTDSPLHWRTNMGDGKPRKWQGTELKHQQ",
        "proteome": "UP000019804",
        "gene": "EURHEDRAFT_467222",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e119e0c8270e59fabb9705b99b044ae3e99f8c08",
        "counters": {
            "domain_architectures": 6717,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6717
        }
    }
}