HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A017H850",
"id": "A0A017H850_9RHOB",
"source_organism": {
"taxId": "1122180",
"scientificName": "Limimaricola hongkongensis DSM 17492",
"fullName": "Limimaricola hongkongensis DSM 17492"
},
"name": "Ureidoglycolate lyase",
"description": [
"Catalyzes the catabolism of the allantoin degradation intermediate (S)-ureidoglycolate, generating urea and glyoxylate. Involved in the utilization of allantoin as nitrogen source"
],
"length": 162,
"sequence": "MSREIRTEPLTRDAFAPFGDVIEAAGAPDKLINQGLCGRHHDLARLDFGDGGRAGISVFDAKPRALPYSLEMVERHPEGSQAFVPMSLASFLVIVAPDAGGAPGQPRAFVTTPGQGINLLRGTWHGVLTPLEAPGLFAVIDRIGETANLEEHWFDAPWTVTG",
"proteome": "UP000025047",
"gene": "allA",
"go_terms": [
{
"identifier": "GO:0004848",
"name": "ureidoglycolate hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050385",
"name": "ureidoglycolate lyase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000256",
"name": "allantoin catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cbbabf21573d1421eca4c02f394c304b82259bd1",
"counters": {
"domain_architectures": 7173,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"pirsf": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7173
}
}
}