GET /api/protein/UniProt/A0A016QUM6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A016QUM6",
"id": "A0A016QUM6_9DEIO",
"source_organism": {
"taxId": "1476583",
"scientificName": "Deinococcus phoenicis",
"fullName": "Deinococcus phoenicis"
},
"name": "Probable RNA 2'-phosphotransferase",
"description": [
"Removes the 2'-phosphate from RNA via an intermediate in which the phosphate is ADP-ribosylated by NAD followed by a presumed transesterification to release the RNA and generate ADP-ribose 1''-2''-cyclic phosphate (APPR>P). May function as an ADP-ribosylase"
],
"length": 176,
"sequence": "MTDEQLSRRLAYLLRHAPGDLGVTLEPGGWVPVRAVLRHLRISREQLARVVATNHKQRYTLDGERIRANQGHSVPVELDLAPAVPPAQLYHGTHPAALPAIRREGLRTMGRHHVHLSPDPQTARRVGARRGTPVVLTVEAGAMHAAGHVFYLSTNGVWLTDAVPPGFLVLPPGLLP",
"proteome": "UP000020492",
"gene": "kptA",
"go_terms": [
{
"identifier": "GO:0003950",
"name": "NAD+ poly-ADP-ribosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016740",
"name": "transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7e8512ca279237ae6767609308c27d1890c0cdb4",
"counters": {
"domain_architectures": 9683,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"hamap": 1,
"pfam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 9683
}
}
}