General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A016QUM6",
        "id": "A0A016QUM6_9DEIO",
        "source_organism": {
            "taxId": "1476583",
            "scientificName": "Deinococcus phoenicis",
            "fullName": "Deinococcus phoenicis"
        },
        "name": "Probable RNA 2'-phosphotransferase",
        "description": [
            "Removes the 2'-phosphate from RNA via an intermediate in which the phosphate is ADP-ribosylated by NAD followed by a presumed transesterification to release the RNA and generate ADP-ribose 1''-2''-cyclic phosphate (APPR>P). May function as an ADP-ribosylase"
        ],
        "length": 176,
        "sequence": "MTDEQLSRRLAYLLRHAPGDLGVTLEPGGWVPVRAVLRHLRISREQLARVVATNHKQRYTLDGERIRANQGHSVPVELDLAPAVPPAQLYHGTHPAALPAIRREGLRTMGRHHVHLSPDPQTARRVGARRGTPVVLTVEAGAMHAAGHVFYLSTNGVWLTDAVPPGFLVLPPGLLP",
        "proteome": "UP000020492",
        "gene": "kptA",
        "go_terms": [
            {
                "identifier": "GO:0003950",
                "name": "NAD+ poly-ADP-ribosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016740",
                "name": "transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7e8512ca279237ae6767609308c27d1890c0cdb4",
        "counters": {
            "domain_architectures": 9683,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "hamap": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9683
        }
    }
}