HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A014MT62",
"id": "A0A014MT62_9BURK",
"source_organism": {
"taxId": "1457173",
"scientificName": "Comamonas aquatica DA1877",
"fullName": "Comamonas aquatica DA1877"
},
"name": "NADPH-dependent 7-cyano-7-deazaguanine reductase",
"description": [
"Catalyzes the NADPH-dependent reduction of 7-cyano-7-deazaguanine (preQ0) to 7-aminomethyl-7-deazaguanine (preQ1)"
],
"length": 282,
"sequence": "MNTPEQSQLGKASAYADQYDPSLLFPIPRSGKREEIGISGALPFFGADLWTAFELSWLNARGKPQVALAHFTIPCETPHIIESKSFKLYLNSFNNSRFDSLEAVQERLREDVNEALWRSAAVRQSSASVRVIAQDAFELQKVQELQGLNLDRLDIECSDYTPRPDLLKADHDNPPVTETLVSHLLKSNCLVTGQPDWGCVQISYTGAAIDQESLLRYIVSFRNHNEFHEQCVERIFMDLTRQCRPLKLSVYARYTRRGGLDINPLRTSHPMALPPNVRTARQ",
"proteome": "UP000020766",
"gene": "queF",
"go_terms": [
{
"identifier": "GO:0008616",
"name": "tRNA queuosine(34) biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0046857",
"name": "oxidoreductase activity, acting on other nitrogenous compounds as donors, with NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b826c406e709a9d74856e11f2b2aa8f9900af214",
"counters": {
"domain_architectures": 6229,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 1,
"ssf": 1,
"hamap": 1,
"pirsf": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6229
}
}
}