GET /api/protein/UniProt/A0A011NCF4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A011NCF4",
        "id": "A0A011NCF4_9PAST",
        "source_organism": {
            "taxId": "85402",
            "scientificName": "Mannheimia granulomatis",
            "fullName": "Mannheimia granulomatis"
        },
        "name": "Leukotoxin translocation ATP-binding protein LktB",
        "description": [
            "Part of the ABC transporter complex LktBD involved in leukotoxin export. Transmembrane domains (TMD) form a pore in the inner membrane and the ATP-binding domain (NBD) is responsible for energy generation",
            "Part of the ABC transporter complex PstSACB involved in phosphate import. Responsible for energy coupling to the transport system"
        ],
        "length": 254,
        "sequence": "MMNTNTKIAVNNLNFYYGDFHALKNINLTIAKNKVTAFIGPSGCGKSSLLRTFNRMFELYPNQKATGEINLDGENLLTTDTDVALLRAKVGMVFQKPTPFPMSIYDNIAFGIRLFEKLPKAELNDRVEWALTKAALWNEVKDKLRQSGDSLSGGQQQRLCIARAIAVKPDVLLLDEPCSALDPISTMKIEELITELKQDYTLAMVTHNMQQAARCSDYTAFMYLGELVEFGETKQIFNEPKVPRTADYILGKMG",
        "proteome": "UP000054123",
        "gene": "AK33_08105",
        "go_terms": [
            {
                "identifier": "GO:0005315",
                "name": "phosphate transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0035435",
                "name": "phosphate ion transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016887",
                "name": "ATP hydrolysis activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "48e3bc51d04b3fd112e2624fb984e1b2e9042b86",
        "counters": {
            "domain_architectures": 1059062,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "profile": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1059062
        }
    }
}