GET /api/protein/UniProt/A0A010RQQ6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A010RQQ6",
        "id": "A0A010RQQ6_PSEFL",
        "source_organism": {
            "taxId": "1042209",
            "scientificName": "Pseudomonas fluorescens HK44",
            "fullName": "Pseudomonas fluorescens HK44"
        },
        "name": "Cytochrome bo(3) ubiquinol oxidase subunit 3",
        "description": [
            "Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron"
        ],
        "length": 208,
        "sequence": "MSNLVTNVGHAHGHDHGHDDHHHDSGEMTVFGFWLYLMTDCILFASIFAVYAVLVNNVAGGPSGHDIFELPYVLGETACLLLSSITYGFAMLALFKGKKTQVLGWLAITFLFGLGFIGMEINEFHTLISEGFGPNRSGFLSGFFTLVGTHGLHVTSGLIWMAIMMYQVNKHGLTSTNKTRLSCLSLFWHFLDVVWICVFTVVYLMGTL",
        "proteome": null,
        "gene": "HK44_018525",
        "go_terms": [
            {
                "identifier": "GO:0004129",
                "name": "cytochrome-c oxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0022904",
                "name": "respiratory electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019646",
                "name": "aerobic electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009486",
                "name": "cytochrome bo3 ubiquinol oxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "663ba42a1d577dd726fd8458ee1fa2f51292c5b5",
        "counters": {
            "domain_architectures": 68158,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 2,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 68158
        }
    }
}