GET /api/protein/UniProt/A0A010R8U8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A010R8U8",
        "id": "A0A010R8U8_9PEZI",
        "source_organism": {
            "taxId": "1445577",
            "scientificName": "Colletotrichum fioriniae PJ7",
            "fullName": "Colletotrichum fioriniae PJ7"
        },
        "name": "MADS-box MEF2 type transcription factor MIG1",
        "description": [
            "Transcription factor acting downstream of the MPS1 MAP kinase (MAPK) cascade during conidiation and plant infection. Required for overcoming plant defense responses and the differentiation of secondary infectious hyphae in live plant cells"
        ],
        "length": 665,
        "sequence": "MGRRKIEIKAIKDDRNRSVTFLKRKGGLFKKAHELSVLCSVDVAVFIFGSNKKLYEYSSTDMREMITRYTYHGGPNEHKGPSDFNGGNDEDEDEDPEGTPPQESHMIPPQFQGQAPFPHMRHHTPSASPPIPNGVPFPQHHGLPVQRGHTPQPGMGSRPGSRQDIRRMGPNMGPQPVGPPGSQQPPVNGYAYMPNPAIYNPQNQPNMPPNMSHGLPQQYQQHGPQYSSYAPNHHPPHMQQHMEDQRRSMPPNYPQQQGPQGPGPQVSRISPSPPQPPTQQLPPQPPQISPPPPQPQQLEPQQQQQQQQQRPHPSPQPQQQQQPQPPQSQQQQQPQQHQPSPPQSEEMPAPSEPRSELPPRPQPPLLNTDSAIKKLPQRKQHSIFTPIDENRSILSQHLASFASEQSIKAEPNRPPFPDQSNIKVEGNRSQSVDVGAVSRTNGSTTPPMPPRASTQSLNKSRNISVSSIPETTFTPPSRTNSMKLGGGARPRLRVEIPDEPSDGGSATAESNSPRNSTESTSQTTRRHASDSHSSGMVLPPPSPSAQTLLSAGATGPPNPFARPPPQQNNNMNIDTPVSALPSRFLNNEFLPSPSSFYPEWYARGGSDSNTLPSPLNFATPVVGSGPSFLRDDNPATKRKSPEISANGPHDGPEAGNEPKRIRVDS",
        "proteome": "UP000020467",
        "gene": "CFIO01_13635",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046983",
                "name": "protein dimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000977",
                "name": "RNA polymerase II transcription regulatory region sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045944",
                "name": "positive regulation of transcription by RNA polymerase II",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9b1d1537f57a287fce1f0a861665d2876b831672",
        "counters": {
            "domain_architectures": 31146,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "profile": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 31146
        }
    }
}