spacer

EBI Dbfetch

ID   Z93947; SV 1; linear; mRNA; STD; MUS; 4466 BP.
XX
AC   Z93947;
XX
DT   11-APR-1997 (Rel. 51, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 8)
XX
DE   M.musculus mRNA for semaphorin H (4466 bp)
XX
KW   semaphorin H.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [2]
RP   1-4466
RA   Christensen C.;
RT   ;
RL   Submitted (10-APR-1997) to the INSDC.
RL   Christensen C., Danish Cancer Society, Molecular Cancer Biology,
RL   Strandboulevarden 49, Copenhagen, Sealand, Denmark, 2100
XX
RN   [3]
RX   PUBMED; 9515811.
RA   Christensen C.c., Tarabykina S.s., Hulgaard E.e., Kramerov D.d.,
RA   Lukanidin E.e.;
RT   "Transcription of a novel mouse semaphorin gene, M-semaH, correlates with
RT   the metastatic ability of mouse tumor cell lines";
RL   Cancer Res. 58(6):1238-1244(1998).
XX
DR   MD5; 4690cf7274d771d549c8ba15c405f33f.
DR   Ensembl-Gn; ENSMUSG00000063531; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073957; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4466
FT                   /organism="Mus musculus"
FT                   /strain="Balb/cfC3H"
FT                   /mol_type="mRNA"
FT                   /cell_line="66cl4"
FT                   /db_xref="taxon:10090"
FT   CDS             610..2943
FT                   /gene="msema"
FT                   /product="semaphorin H"
FT                   /note="predicted protein"
FT                   /note="The coding sequence of the msemaH transcript is
FT                   identical to the submission with Acc. number z80941"
FT                   /db_xref="GOA:P70275"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR015513"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="MGI:MGI:1340034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70275"
FT                   /protein_id="CAB07987.1"
FT                   /translation="MAPAGHILTLLLWGHLLELWTPGHSANPSYARLPLSHKELFELNG
FT                   LQYFKAPLGFLDLHTMLLDEYQERLFVGGRDLVYSLNLERVSDGYREIYWPSTAVKVEE
FT                   CIMKGKDANECANYIRVLHHYNRTHLLTCATGAFDPHCAFIRVGHHSEEPLFHLESHRS
FT                   ERGRGRCPFDPNSSFVSTLVGNELFAGLYSDYWGRDSAIFRSMGKLGHIRTEHDDERLL
FT                   KEPKFVGSYMIPDNEDRDDNKMYFFFTEKALEAENNAHTILHPSGRLCVNDMGGQRILV
FT                   NKWSTFLKARLVCSVPGMNGIDTYFDELEDVFLLPTRDPKNPVIFGLFNTTSNIFRGHA
FT                   VCVYHMSSIREAFNGPYAHKEGPEYHWSLYEGKVPYPRPRSCASKVNGGKYGTNQRLPD
FT                   DAIRFARMHPLMYQPIKPVHKKPILVKTDGKYNLRQLAVDRVEAEDGQYDVLFIGTDTG
FT                   IVLLKVITIYNQETEWMEEVILEELQIFKDPAPIISMEISSKRQQLYIGSASAVAQVRF
FT                   HHCDMYGSACADCCLARDPYCAWDGISCSRYYPTGAHEKRRFRRQDVRHGNAAQQCFGQ
FT                   QFVGDALDRTEERLAYGIESNSTLLECTPLSLQAKVIWFLQKGRDVRKEEVKTDDRVVK
FT                   MDLGLLFLRVRKSDAGTYFCQTVEHNFVHTVRKITLEVVEEHKVEGMFHKDHEEERHHK
FT                   MPCPPLSGMSQGTKPWYKEFLQLIGYSSKFQRVEEYCEKVWCTDKKRKKLKMSPSKWKY
FT                   ANPQEKRLRSKAEHFRLPRHTLLS"
XX
SQ   Sequence 4466 BP; 1289 A; 950 C; 1024 G; 1203 T; 0 other;
     aattcggcac gagttcctag aaacgcgcgc gggctcaacc ctgcctgaac tttcctgtaa        60
     acagagcgct gacaggcggc atccccgctg ggtggatccc gcgccctggc gcaagtggca       120
     cttcttgctt ctaattatcg agaggagagg cgaatacgaa ctagctgctc ggcaagtcag       180
     tgtcaggagg ctgacttctg ggaggctggc ggggaggctg ggggaagagc tgggggaggc       240
     tgctgctctg cttcgactgt tttctcaatg aatagctggc ggggagactg aagctagcca       300
     cagcctcctc cttcactccg cgtctgggct gacggcgaca gcaccagccc ggacctggct       360
     ctcaagacgc gctccttgga cggtctcttg ctccgcgctt ctaaccaccg ggcccaaaga       420
     cagaaaggct tagcggatcc aaatattgcc cggcaaatgg cacttgggaa tggtattttc       480
     tgatgacaac cccttctgtt tgtgacaaag cctgtcgccc gccagttgcc cctggaggga       540
     agtactaagt aaaactcaat cctgtcttaa agtgtggctg caggggccag aggagagcca       600
     gcacgcacca tggcaccggc cggacacatc ctcacgttgc tgctctgggg tcacctgctg       660
     gaactctgga ccccaggtca ctcggcgaac ccctcctacg ccaggctacc gctgtcacat       720
     aaagaacttt tcgaactgaa tggacttcaa tatttcaaag ccccccttgg atttcttgat       780
     ctccatacaa tgctgctgga tgagtatcaa gaacggctct ttgtgggagg cagagacctt       840
     gtctattccc tgaacttgga acgagtgagt gacggctaca gagagatata ctggccgagc       900
     acagcagtaa aggtagaaga atgcataatg aaaggaaaag acgcaaatga gtgtgccaat       960
     tatatccggg ttttgcatca ctacaacagg acacaccttc tgacctgtgc tactggtgct      1020
     tttgatccac actgtgcctt catcagagtc gggcaccatt cagaggaacc cctgtttcac      1080
     ctggagtcac acagatctga gagaggaagg ggcagatgtc cttttgaccc caactcctcc      1140
     tttgtgtcca cgctagttgg gaatgagctg tttgctggac tctacagtga ctattggggc      1200
     agagactcgg cgatcttccg cagcatgggg aagttaggcc atattcgcac tgagcatgac      1260
     gatgagcggc tcctgaaaga accaaaattt gtaggttcat atatgattcc tgataacgaa      1320
     gaccgagatg acaacaaaat gtactttttc tttactgaga aggcgctgga ggcggagaac      1380
     aacgcccaca cgatcttaca cccgagtggg cggctgtgcg tgaatgacat gggaggacag      1440
     agaatcctgg tgaacaagtg gagcactttc cttaaagcgc ggctggtttg ctcagtgccg      1500
     ggaatgaatg gaatcgacac atactttgac gaactagagg atgtgttttt actgccgacc      1560
     agagatccta agaatccagt gatatttgga ctgtttaata ctaccagcaa tatatttaga      1620
     ggccatgctg tatgtgtgta tcacatgtca agtatccggg aagcctttaa tggcccatat      1680
     gctcataaag aaggccctga ataccactgg tcactatatg aaggaaaagt cccctaccca      1740
     aggcctcgtt cctgtgccag caaagtaaac ggaggcaagt atggaaccaa ccaaagatta      1800
     cccgatgacg ccatccggtt cgcaaggatg catcctctaa tgtatcagcc cataaaacct      1860
     gttcataaaa aaccaatact ggtaaaaaca gatggaaaat acaacctgag gcaacttgcc      1920
     gtggatcggg tggaagcgga ggatggccag tatgacgtct tatttattgg cacagacaca      1980
     ggaattgtgc tgctgaaagt aatcacaatt tacaaccaag aaacagagtg gatggaggaa      2040
     gtcattctag aggaacttca aatattcaag gatccagccc ctatcatttc tatggaaatt      2100
     tcttcaaaga gacaacagct ttacattgga tcagcctctg ctgtggcaca agtcagattc      2160
     catcactgcg acatgtatgg cagtgcttgt gctgactgct gcctggctcg agacccgtac      2220
     tgtgcctggg atggcatatc ctgctccagg tactacccaa caggtgcaca cgaaaagagg      2280
     aggttccgca ggcaggacgt tcggcatggc aacgccgccc aacagtgctt tggacagcaa      2340
     tttgttggag acgcgttgga caggactgaa gagaggctgg cttatggcat agagagcaac      2400
     agtactctgt tggaatgcac cccgctatca ctacaagcaa aagtcatctg gtttctacag      2460
     aagggacgcg acgtaagaaa agaagaggtg aagacggatg acagagttgt caagatggac      2520
     ttgggcttgc tcttcctcag agtacgcaag tcagatgcag ggacctattt ttgccagaca      2580
     gtagaacaca attttgtcca tactgtgcgt aaaatcacct tggaggtggt cgaagagcat      2640
     aaagtggagg gcatgtttca taaggaccat gaagaggaaa gacatcacaa gatgccctgc      2700
     cctcccttaa gcggtatgtc tcaggggaca aaaccgtggt acaaggaatt cttgcagctg      2760
     attggctaca gcagcaagtt ccagagagtg gaagaatact gcgaaaaggt gtggtgtaca      2820
     gataagaaga ggaaaaagct taaaatgtct ccctccaagt ggaagtatgc caacccccag      2880
     gaaaagaggc ttcgctctaa agctgagcac ttccgcctgc ccaggcacac gctgctctcc      2940
     tgagggcgcc ctctgccggc ggctgaggaa cctaggatgg aaacattttt ttaaaggggg      3000
     ggaaaaaaaa aagactgaaa gcatgcagtc tctttcatta cttcaaagaa ctttctgtag      3060
     tactgagagg ctgggaaggt gttttaagtt attctgcata tcatctgact gtacaaacat      3120
     ctctctcaca gtactagtac ttaaacgagt gtattgcttt aaaaggcttc acctatttat      3180
     caacatatga tcgggctgta attttgagct tgcttttcag ggaaattatt ttgccattgg      3240
     gatatgtatt ataattataa tattaaagaa aaagttatag gttttcataa tcaagaaaaa      3300
     tgtaaaactc tttctggagt tttttctttt ttcttttcct ctttgcagcc ataaggtaaa      3360
     atatacagaa tatcagatat tgtagaatta tcgtgtgagc tttctggtca gttgttgatt      3420
     ttttttttta agccataagt tgtatgtagc tgtgttgtgg ttgctataaa ctgtacaaga      3480
     aatctgcaac ccatccattc tgaggcttgt tctcttcatg aaacactcac taaactatat      3540
     taagaatatt tctgttttat aaacaagaca tatcttttaa atttcacttc agtgtggaag      3600
     gatggaagat agcctctcag aaagatattt ttaaatagtt tcaaaccatg aaagtagaat      3660
     tctgttaaaa acggtctgtg cttccctctt gtggtacaag aaggcattcg atctctcaat      3720
     gctgtttcca taattttcct cgaatgactt gaaaacaaaa tgtagtagat acatctagtt      3780
     cactattcag aagactcaat taaaaaataa ttttatataa taatttaata tggaaatagc      3840
     atgcttctgg ttaattcatt acttcacaac aaaccgaaga tgttaactgc atttgagctt      3900
     tgaaatagaa gaaagtacct ttccagtcct accctgagac aagacactct gaaagtgtgc      3960
     tttacccgca aagaaattat caacgattct tttctcagaa atgaaatctt cctattttat      4020
     atttacttct tggattcgtt ttactactga catctttaga gaatcattat ctttgtctta      4080
     tgaatataat caaaatttat atttttcaga atgtttattt cttgagattt ttcttctctg      4140
     tattttaaag agccagcagc ttccgttcta aaatatgatt tttatgaggc ttttcagttc      4200
     ggtaagagta acgcaagtgg attgtaataa gaacaattat gaatacgtat tcagacttaa      4260
     atttaactat tatgtcagct atctcagtat gctatataat taagaatata aagtgttgag      4320
     aacttctaat ggatttcttt ttctgtctaa aattaggtac tacataaata ttccacaatt      4380
     ttcaaatttt aaaattttgg aaattttaaa gtccagaatt tctaaaacat ataactagta      4440
     tgaataaaga gaatgttgac atcctc                                           4466
//


spacer
spacer