Dbfetch

ID   U82536; SV 1; linear; mRNA; STD; MUS; 1959 BP.
XX
AC   U82536;
XX
DT   04-JUN-1997 (Rel. 52, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus fatty acid amide hydrolase mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1959
RX   DOI; 10.1073/pnas.94.6.2238.
RX   PUBMED; 9122178.
RA   Giang D.K., Cravatt B.F.;
RT   "Molecular characterization of human and mouse fatty acid amide
RT   hydrolases";
RL   Proc. Natl. Acad. Sci. U.S.A. 94(6):2238-2242(1997).
XX
RN   [2]
RP   1-1959
RA   Cravatt B.F., Giang D.K.;
RT   ;
RL   Submitted (17-DEC-1996) to the INSDC.
RL   The Skaggs Institute of Chemical Biology, The Scripps Research Institute,
RL   10550 North Torrey Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 4d853b8377f69e90ad3ee9c590ed08c7.
DR   Ensembl-Gn; ENSMUSG00000034171; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049095; mus_musculus.
DR   EuropePMC; PMC20071; 9122178.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1959
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             7..1746
FT                   /codon_start=1
FT                   /product="fatty acid amide hydrolase"
FT                   /db_xref="GOA:O08914"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR030560"
FT                   /db_xref="MGI:MGI:109609"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08914"
FT                   /protein_id="AAB58506.1"
FT                   /translation="MVLSEVWTALSGLSGVCLACSLLSAAVVLRWTRSQTARGAVTRAR
FT                   QKQRAGLETMDKAVQRFRLQNPDLDSEALLALPLLQLVQKLQSGELSPEAVLFTYLGKA
FT                   WEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHASTLGLSLNEGVT
FT                   SESDCVVVQVLKLQGAVPFVHTNVPQSMLSYDCSNPLFGQTMNPWKPSKSPGGSSGGEG
FT                   ALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKSCVYGQTAVQLSVG
FT                   PMARDVDSLALCMKALLCEDLFRLDSTIPPLPFREEIYRSSRPLRVGYYETDNYTMPTP
FT                   AMRRAVMETKQSLEAAGHTLVPFLPNNIPYALEVLSAGGLFSDGGCSFLQNFKGDFVDP
FT                   CLGDLVLVLKLPRWFKKLLSFLLKPLFPRLAAFLNSMCPRSAEKLWELQHEIEMYRQSV
FT                   IAQWKAMNLDVVLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDD
FT                   AQMEHYKGYFGDMWDNILKKGMKKGIGLPVAVQCVALPWQEELCLRFMREVERLMTPEK
FT                   RPS"
XX
SQ   Sequence 1959 BP; 394 A; 556 C; 583 G; 426 T; 0 other;
     tgggtcatgg tgctgagcga agtgtggacc gcgctgtctg gactctccgg ggtttgccta        60
     gcctgcagct tgctgtcggc ggcggtggtc ctgcgatgga ccaggagcca gaccgcccgg       120
     ggcgcggtga ccagggcgcg gcagaagcag cgagccggcc tggagaccat ggacaaggcg       180
     gtgcagcgct tccggctgca gaatcctgac ctggattcag aggccttgct ggctctgccc       240
     ctgctccaac tggtacagaa gttacagagt ggggaactgt ccccagaagc tgtgctcttt       300
     acctacctgg gaaaggcctg ggaagtgaac aaagggacca actgtgtgac ctcctatctg       360
     actgactgtg agactcagct gtcccaggcc ccacggcagg gcctgctcta tggcgtcccc       420
     gtgagcctca aggaatgctt cagctacaag ggccatgctt ccacactggg cttaagtttg       480
     aacgagggtg tgacatcgga gagtgactgt gtggtggtgc aggtactgaa gctgcaggga       540
     gctgtgccct ttgtgcacac caacgtcccc cagtccatgc taagctatga ctgcagtaac       600
     cccctctttg gccagaccat gaacccgtgg aagccctcca agagtccagg aggttcctca       660
     gggggtgagg gggctctcat tggatctgga ggctcccctc tgggtttagg cactgacatc       720
     ggcggcagca tccggttccc ttctgccttc tgtggcatct gtggcctcaa gcctactggg       780
     aaccgcctca gcaagagtgg cctgaagagc tgtgtttatg gacagacagc agtgcagctt       840
     tctgttggcc ccatggcacg ggatgtggat agcctggcat tgtgcatgaa agccctactt       900
     tgtgaggatt tgttccgctt ggactccacc atccccccct tgcccttcag ggaggagatc       960
     tacagaagtt ctcgacccct tcgtgtggga tactatgaaa ctgacaacta caccatgccc      1020
     actccagcca tgaggagggc tgtgatggag accaagcaga gtctcgaggc tgctggccac      1080
     acgctggtcc ccttcttacc aaacaacata ccttatgccc tggaggtcct gtcggcaggt      1140
     gggctgttca gtgatggtgg ctgctctttt ctccaaaact tcaaaggcga ctttgtggat      1200
     ccctgcttgg gggacctggt cttagtgctg aagctgccca ggtggtttaa aaaactgctg      1260
     agcttcctgc tgaagcctct gtttcctcgg ctggcagcct ttctcaacag tatgtgtcct      1320
     cggtcagccg aaaagctgtg ggaactgcag catgagattg agatgtatcg ccagtccgtc      1380
     attgcccagt ggaaggcaat gaacttggac gtggtgctaa cccccatgct gggtcctgct      1440
     ctggatttga acacaccggg cagagccaca ggggctatca gctacactgt tctctataac      1500
     tgcctggact tccctgcggg ggtggtgcct gtcaccactg tgaccgctga ggacgatgcc      1560
     cagatggaac actacaaagg ctactttggg gatatgtggg acaacattct gaagaagggc      1620
     atgaaaaagg gtataggcct gcctgtggct gtgcagtgcg tggctctgcc ctggcaggaa      1680
     gagctgtgtc tgcggttcat gcgggaggtg gaacggctga tgacccctga aaagcggcca      1740
     tcttgagggt cattcatctg cccagctctg gaggacctaa ggcccatgcg ctctgcactg      1800
     cagccccatc tattcaggat cctgccaccc atgaggagat gcccagcacg ggaagaggca      1860
     accacctgcc ctcccctgga ctcctacaga aacccaggac atgccctcca taaccaagtc      1920
     tggaccagct cccccggaat tcctgcagcc cgggggatc                             1959
//