spacer

EBI Dbfetch

ID   BC132413; SV 1; linear; mRNA; STD; MUS; 5340 BP.
XX
AC   BC132413;
XX
DT   02-FEB-2007 (Rel. 90, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus NLR family, apoptosis inhibitory protein 1, mRNA (cDNA clone
DE   MGC:164044 IMAGE:40130690), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5340
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-5340
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-JAN-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; da18beecde93913f122837308a5b7607.
DR   Ensembl-Gn; ENSMUSG00000021640; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022142; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 6 Row: F Column: 11.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5340
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_391"
FT                   /clone="MGC:164044 IMAGE:40130690"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR-XL-TOPO; Clone identification sequence
FT                   tag: ACAACTCA"
FT                   /db_xref="taxon:10090"
FT   gene            1..5340
FT                   /gene="Naip1"
FT                   /note="synonym: Naip-rs1"
FT   CDS             160..4371
FT                   /codon_start=1
FT                   /gene="Naip1"
FT                   /product="Naip1 protein"
FT                   /db_xref="GOA:Q9QWK5"
FT                   /db_xref="InterPro:IPR001370"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1298223"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QWK5"
FT                   /protein_id="AAI32414.1"
FT                   /translation="MAEHGESSEDRISEIDYEFLPELSALLGVDAVQLAKSQEEEEHKE
FT                   RMKMKKGFNSQMRSEAKRLKTFETYDTFRSWTPQEMAAAGFYHTGVKLGVQCFCCSLIL
FT                   FGNSLRKLPIERHKKLRPECEFLQGKDVGNIGKYDIRVKSPEKMLRGGKARYHEEEARL
FT                   ESFEDWPFYAHGTSPRVLSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFP
FT                   KCEFLQSKKSSEEIAQYIQGYEGFVHVTGEHFVNSWVRRELPMVSAYCNDSVFANEELR
FT                   MDTFKDWPHESPVAVDALVRAGLFYTGKKGIVQCFSCGGCMEKCTEGDDPIQEHNKFFP
FT                   NCVFLQTPKSSAEVIPALQSHCALPEAMETTSESNHDDPAAVHSTVVGLGRSEAQWFQE
FT                   ARSLSEQLRDNYTKATFRHMNLPEVCSSLGTDHLIGCDVSIISKHISQPVQGALTIPEV
FT                   FSNLSSVMCVEGETGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGLAN
FT                   IICAQLLGAGGCISEVCLSSIIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTC
FT                   LLIAVHTNRVRGIRSYLDTSLEIKEFPLSNTVYILKKFFSHNIKRLLEFMVYFGQNEDL
FT                   QGIHKTPLFVAAVCTDWFENPSDQPFQDMALFKSYMQYLSLKHKGAAKPLQATVSSCGQ
FT                   LALTGLFSSCFEFNSDDLAEAGVDEDEELTTCLMSKFTAQRLRPVYRFLGPLFQEFLAA
FT                   MRLTELLSSDRQEDQDLGLYYLRQINSPLKALTTYNNFLKYVFSHPSSKAGPTVVSHLL
FT                   HLVDETELLENTYKNEDYVNHPPGTSRIMKGLKELWLLSPEYYSSFVSEHLLRIALNFA
FT                   YESNTVAECSPFILQFLRGRTLALKVLNLQYFRDHPESLLLVKSLEVSINGNKVPKVVD
FT                   YSVMEKSFETLQPPTIDQDYASAFEQMKEHEKNLSENEETIKSIKNIFPLQPPKISSGY
FT                   WKLSPKPCKIPRLEVGVTNMGPADQALLQVLMEVFSASQSIEFRLSDSSGFLESIRPAL
FT                   ELSKASVTKCSMSRLELSRAEQELLLTLPALQSLEVSETNQLPDQLFHNLHKFLGLKEL
FT                   CVRLDGKPDVLSVLPGEFPNLLHMEKLSIRTSMESDLSKLVKLIQNSPNLHVFHLKCDF
FT                   LSNCDSLMAVLASCKKLREIEFSGRCFEAMPFVNILPNFISLKILNLISQQFPDKETSE
FT                   KFAQALGSLRNLEELLVPTGDGIHQVAKLIVRQCLQLPCLRVLAFHYILDNDSVIEIAR
FT                   VATSGGFQKLEKLDLSMNHKITEEGYRNFFQALDNLPNLQNLNICRHIPECIQVQATTV
FT                   KALGQCVSRLPSLTRLHMLSWLLDEEDMKVINDVKERHPQSKRLIIFWKWIVPFSPVVL
FT                   E"
FT   misc_difference 3519
FT                   /gene="Naip1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 4752
FT                   /gene="Naip1"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
FT   misc_difference 5031
FT                   /gene="Naip1"
FT                   /note="'T' in cDNA is 'G' in the mouse genome."
XX
SQ   Sequence 5340 BP; 1490 A; 1205 C; 1247 G; 1398 T; 0 other;
     gcgaggaagc catggagact ccttctccct tgggacatca ggtctcggtt tgtaagcaga        60
     ctttagttcc tgttagagag acacaaagtt ctgatatggg aaatctcatt gcaggaaacc       120
     acctgaggaa gaagcaggag cctgactgaa ctgaagaaaa tggctgagca tggggagtcc       180
     tccgaggatc ggatttctga gattgattat gaatttctcc ctgagctctc tgctcttctc       240
     ggggtggatg cagttcagct ggcaaagagc caagaagaag aagagcataa agaacggatg       300
     aaaatgaaga aaggttttaa ctcacagatg cgcagtgaag ccaaacgact aaagaccttt       360
     gagacctatg acacgttcag atcatggacg ccacaggaga tggcagctgc tgggttttac       420
     cacacagggg tgaaacttgg ggttcagtgc ttttgctgta gcttgatcct ctttggcaat       480
     agcctcagga agcttcccat agagagacac aagaaattac gtccagaatg tgagttcctt       540
     cagggaaaag atgttggtaa cattggcaag tatgacatcc gggtgaagag tccagagaag       600
     atgctgagag gtggcaaagc caggtaccat gaagaggagg ccagactgga gtcctttgag       660
     gactggccat tttatgccca tgggacatca ccacgtgtac tctcagcagc tggctttgtc       720
     tttacaggta aaagggacac tgtgcagtgt ttttcctgtg gcggaagctt gggcaactgg       780
     gaagaaggag atgacccctg gaaggagcat gccaagtggt tccccaaatg tgaatttctt       840
     caaagtaaga aatcttcaga ggaaattgcc cagtatatcc aaggctatga gggatttgtt       900
     catgtaacgg gagaacattt tgtgaattcc tgggtcagaa gagaattacc tatggtatca       960
     gcttactgca acgacagcgt cttcgctaat gaagaactaa ggatggacac gtttaaggac      1020
     tggccccacg aatcacctgt ggctgttgat gctttggtca gagctggcct tttctacaca      1080
     ggcaaaaagg gcattgtcca gtgtttttcc tgtggaggat gtatggagaa gtgcacagaa      1140
     ggtgacgacc caatacaaga gcacaacaag ttttttccca actgtgtatt tctccaaacc      1200
     ccgaagtcct ctgcagaagt gattccagcc cttcagagcc actgtgcact tccagaagcc      1260
     atggaaacca caagtgaaag caaccacgat gatccagcag cagttcattc tacagtggtg      1320
     ggcttgggta ggagtgaagc ccagtggttt caagaggcca ggagtctgag tgagcagcta      1380
     agagacaact acactaaagc cacttttcgc cacatgaact tgccagaagt gtgctccagc      1440
     cttggcactg accacttgat cggctgcgat gtgtccatca tttcaaagca catcagccag      1500
     cctgtgcaag gggccctgac gatccctgag gtcttctcca atctcagctc tgtcatgtgt      1560
     gtggaggggg aaactggcag tggaaagaca accttcctga agaggatagc ttttctctgg      1620
     gcatcaggat gctgcccctt gttgtacagg ttccagctgg tcttctacct ctcccttagt      1680
     tccatcacac cagaccaggg actggccaac atcatctgtg cccaactcct aggggcagga      1740
     ggctgcatta gtgaagtgtg tctgagcagc atcatccagc agttacaaca ccaggtgctg      1800
     ttcctgttgg atgactacag tgggctggcc tcactccccc aagccctaca tacactgatt      1860
     acaaaaaact acttgtcacg gacctgctta ttgatcgctg tgcatacaaa cagggtcagg      1920
     ggcatccgct catacctaga tacgagtcta gagatcaaag agtttccctt gtccaatact      1980
     gtctatatat taaagaagtt cttctcccat aatataaaac gtctactaga gtttatggtt      2040
     tattttggac agaatgaaga tttacaggga attcacaaga cccccctctt cgtggcagca      2100
     gtatgtactg actggtttga aaatccatct gaccagccct ttcaggatat ggcacttttc      2160
     aagtcctaca tgcaatacct gtccttaaag cacaaaggtg cagctaagcc tctccaagcc      2220
     accgtgtcct catgtgggca gctggccttg acagggcttt tctcatcatg ctttgagttc      2280
     aatagtgatg acctggcaga ggcaggagtt gatgaagatg aagagctcac cacctgcttg      2340
     atgagcaaat tcaccgccca gagactgagg ccagtctacc ggtttttagg tccgctgttc      2400
     caggagtttc ttgctgccat gagactgact gaacttctga gttcagatag gcaggaagac      2460
     caagatctgg gactttatta tttgagacaa attaactcac ccttgaaggc tttgaccacc      2520
     tacaacaatt ttttgaagta tgtctttagc catccgtcat caaaggcagg gccaacagtt      2580
     gtatctcatt tgcttcactt ggtggatgag acagagttgc tggagaatac ctataaaaat      2640
     gaggattatg taaatcaccc tccaggaact tcccgaataa tgaagggact taaggaactg      2700
     tggctgttat ctcctgaata ttactcttca tttgtttcag aacatttatt gcgcattgct      2760
     ctaaactttg cttatgaaag caacactgtt gctgaatgtt ctccatttat tttgcagttc      2820
     cttagaggga gaacactggc tttgaaagta ctgaatttac aatactttag ggaccaccca      2880
     gaaagcctgt tactggtgaa gagtttagaa gtctcgataa atggaaataa agtgccaaaa      2940
     gttgtagatt attcagtcat ggaaaaaagt tttgaaacat tacagccacc aactatagat      3000
     caggactatg catccgcctt tgaacaaatg aaggaacatg aaaaaaattt atctgaaaat      3060
     gaagagacca taaagagtat taagaacatc ttccccttac agccacctaa aataagctct      3120
     ggctattgga aactgtcccc caagccatgc aagatcccta ggctggaagt tggagtgacc      3180
     aacatgggtc cagcagatca agcactgctc caggtcctca tggaagtctt ctcagcttca      3240
     cagagtattg agttccgttt atccgacagc agtggcttcc ttgaaagcat ccgcccagct      3300
     ctggagctga gtaaggcctc tgtcaccaag tgttccatgt ccaggctgga gctcagcaga      3360
     gcagaacagg agctgcttct caccctgcct gccctgcagt ctctcgaggt ctcagagaca      3420
     aaccagttac cagatcagct cttccataac ttgcacaagt tcctgggcct gaaagaactg      3480
     tgtgtgagac tagatggcaa accggatgtg ctctcagttc ttcctggaga gttcccaaac      3540
     ctccttcaca tggagaagtt atccatccga acctccatgg agtctgacct ctccaaacta      3600
     gttaaattga ttcagaactc tccaaatctc catgttttcc atctgaaatg tgatttcctt      3660
     tcgaattgtg actctctcat ggctgtgctt gcttcctgca agaaactcag agagattgag      3720
     ttttctggac gatgctttga agccatgccc tttgttaaca ttttgccaaa ttttatttct      3780
     ctgaagatat taaatcttat aagccaacaa ttcccagata aggaaacatc agaaaagttt      3840
     gcccaggctc tgggttctct caggaacctg gaggaactgc tcgttcccac tggagacggg      3900
     attcaccaag tggccaaatt gattgtccgg cagtgtctgc agcttccgtg tctccgagtt      3960
     cttgcctttc actacatctt ggacaatgac agtgtgattg aaattgccag ggtggcaacc      4020
     agtggaggtt tccagaaact cgagaagtta gatctttcca tgaatcacaa gattaccgag      4080
     gaaggatata gaaatttctt tcaagccctg gacaacctgc caaacttgca gaatctgaac      4140
     atctgcagac atatcccaga atgcattcaa gttcaggcca ccactgtcaa ggctctgggt      4200
     caatgtgtgt cccgactgcc cagcctcact aggctgcaca tgctcagttg gctcctggat      4260
     gaagaggaca tgaaagtgat taatgatgtg aaggaaagac acccccagtc caaacgcttg      4320
     attatcttct ggaaatggat agtcccgttc tctcctgttg tcctggagta aaggatgctc      4380
     ctgaagacta ctgatagttc agaataccag atttcctaaa acactttact ttagctgggc      4440
     atggtggtac acacctgtac tttcaacatt taggacactg atgtgcaaga atcaagaagt      4500
     tcagaccaga tccagtttca cagctaaaga cacaactatc catcctacta aagaatattt      4560
     attaagtgtg cagactgcta attttttttc agaagtctgc atgcccacta ttgaattcag      4620
     tagctatatt gctcaatgcc ttggcagtcc ttatttggtc ttcctgtctg aagactagag      4680
     cctcagtcac gttcatatag agaactgtca atgccaaggt caacaggaag gcgctgggaa      4740
     aggaacatcg aactatgtag aagccacatc cggaagtagt atttgatagg tgctggggta      4800
     gtgcaagagg aacagcaaaa cagctttaga actcacggaa cgcagtctcc tggttagcac      4860
     aaactcatgg gtgggtctcc gagagaacta tgggtcctga gagcttcatg gtgtcataga      4920
     gatttgctct gcttgctgcc ttctcactgt gttactcata atctatgagt tttatgaact      4980
     ctctaggggg cttaacaacc cctcactggg cagtgtcatt gtcactcaca tcagcagtgc      5040
     ttgatcttca agatcaatga ttcaatcacc acccttggaa agaacttaga aatgtacatt      5100
     gttagaaatg accaccagtc ttaagaattt ggagaagtag attgtcagta aagttaggtt      5160
     aagatgtttt tgttaatggc tctgatgttg aaaaatctta gaaatcaaat agaaattcag      5220
     aaaagcccac ttttgattat tgatcaaggg atgttttcaa gatcaggaac aagaacaatg      5280
     gcagctcagc tagcactggc tgatgtgact cttgctgaag ctgggctgat gatcgaggtg      5340
//


spacer
spacer