spacer

EBI Dbfetch

ID   BC023893; SV 1; linear; mRNA; STD; MUS; 2083 BP.
XX
AC   BC023893;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus cysteine-rich with EGF-like domains 1, mRNA (cDNA clone
DE   MGC:36401 IMAGE:5310111), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2083
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2083
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-FEB-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 2cc83a91949cc3291546807688ac0166.
DR   Ensembl-Gn; ENSMUSG00000030284; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032422; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 56 Row: e Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 19527147.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2083
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="MGC:36401 IMAGE:5310111"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2083
FT                   /gene="Creld1"
FT   misc_difference 1..5
FT                   /gene="Creld1"
FT                   /note="5 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 7
FT                   /gene="Creld1"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 10..11
FT                   /gene="Creld1"
FT                   /note="in the mouse genome : TC."
FT   CDS             346..1608
FT                   /codon_start=1
FT                   /gene="Creld1"
FT                   /product="cysteine-rich with EGF-like domains 1"
FT                   /db_xref="GOA:Q91XD7"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR002049"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR021852"
FT                   /db_xref="MGI:MGI:2152539"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91XD7"
FT                   /protein_id="AAH23893.1"
FT                   /translation="MAPLPPRGLVPSLLWCLSLFLSLPGPVWLQPSPPPHPSPRAEPHP
FT                   CHTCRALVDNFNKGLERTIRDNFGGGNTAWEEEKLSKYKDSETRLVEVLEGVCSRSDFE
FT                   CHRLLELSEELVENWWFHRQQEAPDLFQWLCSDSLKLCCPSGTFGPSCLPCPGGTERPC
FT                   GGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNSSHLVCSACFGPCARCT
FT                   GPEESHCLQCKKGWALHHLKCVDIDECGTEQATCGADQFCVNTEGSYECRDCAKACLGC
FT                   MGAGPGRCKKCSRGYQQVGSKCLDVDECETVVCPGENEKCENTEGGYRCVCAEGYRQED
FT                   GICVKEQVPESAGFFAEMTEDEMVVLQQMFFGVIICALATLAAKGDLVFTAIFIGAVAA
FT                   MTGYWLSERSDRVLEGFIKGR"
FT   misc_difference 2046..2083
FT                   /gene="Creld1"
FT                   /note="polyA tail: 38 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2083 BP; 438 A; 583 C; 607 G; 455 T; 0 other;
     ccacgcgtcc gggaatattt tgggatccaa ccctctctct aattttggcc cctaataact        60
     cactgagacc ctaaaacaat gggctgacgc ttattctttt gcccgcgatc ccggccacct       120
     ccccctacgg taacggagaa ataatttctc tgctggaatc gtagattagg ctctttcacc       180
     ccttccagcg cctctgcttc cactacccca gtttatcctc gttttgtaat tacgtaggtc       240
     tggggctctg agccccaagg cgcctcgctt tcctccctta cagcctggct tctccagtga       300
     accctccccc tgccctctat ctgcacgtcc ccagcctggg aaaagatggc tccactgccc       360
     ccaaggggcc tggtcccatc tctgctctgg tgcttgagcc tgtttctgag cctcccagga       420
     cctgtctggc tccaaccctc tcctcctccc catccttctc cccgagctga gccccatccg       480
     tgtcatacct gccgggcact ggtggacaac ttcaacaagg gcctggagag aaccatccgg       540
     gacaacttcg ggggtggaaa cacggcctgg gaggaagaga agttgtccaa atacaaagac       600
     agtgagaccc gcctggtgga ggtgctggag ggcgtgtgca gcaggtcaga cttcgagtgc       660
     caccgcctgc tcgagctgag cgaggagctg gtggaaaact ggtggtttca caggcagcag       720
     gaagcccccg acctcttcca gtggctctgt tccgattccc tgaagctctg ctgcccctct       780
     ggcacctttg ggccctcctg cctgccatgt cctgggggca cagagaggcc ctgcggtggc       840
     tacgggcagt gtgaagggga agggactcga gggggcagcg ggcactgtga ctgccaagcc       900
     ggctatgggg gcgaggcctg tggccagtgt ggccttggct actttgaggc ggagcgcaac       960
     agcagccatc tggtatgttc ggcgtgtttt ggtccttgtg cccgctgcac gggacctgag      1020
     gaatcccatt gtctgcagtg caagaaaggc tgggccctgc atcacctcaa gtgtgtagac      1080
     atcgatgagt gtggtacaga gcaagccacc tgtggagctg accagttctg tgtgaacaca      1140
     gaaggatcct acgagtgccg agactgtgca aaggcctgcc tgggctgtat gggagcaggg      1200
     ccagggcgct gcaaaaagtg cagccgtggc taccagcagg tgggctccaa gtgcctagat      1260
     gtggatgagt gtgagactgt ggtgtgtcca ggagagaatg agaagtgtga aaacacggag      1320
     ggaggctacc gctgtgtctg tgctgagggc tacagacagg aggacggcat ctgcgtgaag      1380
     gagcaggtcc cggagtcggc gggcttcttt gcggagatga cggaggatga aatggtggtt      1440
     ctgcagcaga tgttctttgg tgtaatcatc tgtgcgctgg ccacgcttgc tgccaagggt      1500
     gacttggtgt tcactgccat cttcattgga gctgtggcag ccatgactgg gtactggttg      1560
     tcagagcgga gtgaccgtgt gctggagggc ttcatcaagg gtagataatc cctgccgcca      1620
     ctcacaggat ttcctcccac ccaggctgct cctagaggtt atttctctct ccctatggat      1680
     acctgggaca gcatagtttc tctttgagac tggggtaaac acccttttac ctgccttact      1740
     gagcagccca ggaccccagt ggccccaggg ggttgaaaaa gaggtcctga agcagatgcc      1800
     acgagatcct agcctaggac actggcaggc ctcaccgtgt atgaatccca agacagtttc      1860
     tccccaggga ggttgcaggt gggctttggc ccctgacccg gatgagaggt gtcccctcag      1920
     gggtgggccc ccataggccc cttgccaggt gcatgctgcc agctccagct gtgtattcac      1980
     cgcccacgcc ctagccatcg acttatttat tcatctcagg aaataaagga cggtcttgaa      2040
     aatggaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaa                        2083
//


spacer
spacer