Dbfetch

LOCUS       NM_068421               2146 bp    mRNA    linear   INV 04-SEP-2019
DEFINITION  Caenorhabditis elegans Netrin receptor unc-5 (unc-5), mRNA.
ACCESSION   NM_068421
VERSION     NM_068421.5
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2146)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2146)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2146)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2146)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Sep 4, 2019 this sequence version replaced NM_068421.4.
FEATURES             Location/Qualifiers
     source          1..2146
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            1..2146
                     /gene="unc-5"
                     /locus_tag="CELE_B0273.4"
                     /db_xref="GeneID:177334"
                     /db_xref="WormBase:WBGene00006745"
     CDS             3..1706
                     /gene="unc-5"
                     /locus_tag="CELE_B0273.4"
                     /standard_name="B0273.4b"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Netrin receptor unc-5"
                     /protein_id="NP_500822.2"
                     /db_xref="EnsemblGenomes-Tr:B0273.4a"
                     /db_xref="EnsemblGenomes-Tr:B0273.4c"
                     /db_xref="GeneID:177334"
                     /db_xref="WormBase:WBGene00006745"
                     /translation="MDEITITTQPKSGYVIRNKPLRLQCRANHATKIRYKCSSKWIDD
                     SRIEKLIGTDSTSGVGYIDASVDISRIDVDTSGHVDAFQCQCYASGDDDQDVVASDVA
                     TVHLAYMRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVVQPDANVIR
                     ASDGSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIYVDGGWSEWSPWIGTCHVD
                     CPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPCKLDGG
                     WSSWSDWSACSSSCHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLCTADSSRIVI
                     SDTAVYGSVASIFIVASFILAILAMFCCKRGNSKKSKPLKPQKMNSEKAGGIYYSEPP
                     GVRRLLLEHQHGTLLGEKISSCSQYFEPPPLPHSTTLRSGKSAFSGYSSTRNAGSRAA
                     LIQECSSSSSGSGGKRTMLRTSSSNCSDDDNYATLYDYMEDKSVLGLDTSQNIVAAQI
                     DSNGARLSLSKSGARLIVPELAVEGEKMLYLAVSDTLTDQPHLKRECKKILKIYISKI
                     S"
ORIGIN      
        1 taatggacga aatcacaatc acaacacaac caaaatccgg ttatgtcatt cgaaataagc
       61 cattgcgtct tcaatgccga gccaatcacg caacaaagat tcgttacaaa tgtagctcaa
      121 aatggatcga cgattctcga atcgaaaagc ttatcggaac cgactcgacg tctggagttg
      181 gatacattga cgcttcagtt gatatttctc gaatcgacgt agacacatct ggacacgttg
      241 acgcttttca gtgtcagtgt tacgcttctg gagacgacga tcaagacgtt gtggcttctg
      301 acgtggcgac agttcatttg gcttatatgc ggaagcactt tctcaaatca cccgttgctc
      361 aacgggttca agaaggcaca accctccaac ttccctgtca agcaccggaa tcagatccga
      421 aagcagagct cacctggtac aaagatggag tcgttgtaca gcctgatgca aatgttatcc
      481 gagcatctga tggaagtcta attatgtcag ccgccagatt atcagacagt ggaaattata
      541 catgtgaagc cacaaatgtg gcgaattcga ggaaaactga cccagtggaa gtacagattt
      601 atgttgacgg tggttggtcc gaatggtccc cgtggatcgg aacgtgtcac gtcgactgtc
      661 cccttctccg tcaacacgcc catcgaatcc gtgatccgca tgacgttctg ccccatcaga
      721 gaagaacacg aacttgtaat aatccagctc cattgaacga cggagagtac tgtaagggag
      781 aagaagaaat gacgagaagc tgtaaagtac catgtaaact tgatggagga tggagttcat
      841 ggagtgattg gagtgcttgc tcttcgagtt gtcatcggta taggacgaga gcatgtaccg
      901 ttccacctcc gatgaatgga ggacagccat gttttggaga tgatctgatg acacaagagt
      961 gtccggcaca gctttgcact gcggactcct ctcggatagt aatcagtgat actgctgttt
     1021 atggatcagt tgcatctatt ttcattgttg cctcatttat tcttgcaatt cttgcaatgt
     1081 tctgctgtaa acgtggcaat tcaaaaaagt cgaaaccatt gaaaccgcag aaaatgaatt
     1141 cggaaaaagc aggaggaatc tactattctg agcctccagg tgttcgaaga ttacttttgg
     1201 agcatcaaca tggaacattg ctcggagaga aaatatcatc gtgttctcaa tattttgagc
     1261 ctcctcctct accacattca acaactcttc gatctggaaa aagtgcattc agtggatatt
     1321 cttcaacaag aaacgctggc tcacgagctg ctttaattca agaatgtagt tcgagtagtt
     1381 caggatctgg tggaaaacgg acaatgctta gaacttcaag ctcaaattgc tcggatgacg
     1441 ataattatgc tacgttatat gattatatgg aagacaagag tgttcttgga ttagacactt
     1501 cacaaaatat tgttgctgcg cagattgata gcaatggagc acgattgtct ttatcaaaaa
     1561 gtggagcaag attaattgta cctgaattgg cagtggaagg agagaaaatg ctttatctgg
     1621 ctgtttcgga caccttaaca gatcaacctc acctcaaacg tgagtgtaaa aaaatattaa
     1681 aaatttacat ttcaaaaatt tcataaaatt ggaaacatac aactacttca ttgtaatagc
     1741 ggacttcatt gcgatacttc attacgatag tcgaaatcat aaatattcct taaataatat
     1801 gtattttttg tcacatcccg agtggtgaag aattcctaac caggaacaca tgagagcaaa
     1861 aaacaaatta attgtttcaa aaatttcata aaatgggatc atttgccacc ctatcgatta
     1921 atgacttgaa aaatagttcg ttggaaataa aaccatagaa acagtgaaag ttttttctgg
     1981 aaattcaatt tatgttatgt gttttttgga ataaaattat actgtttcag tgtggttttt
     2041 ttaatttgtt aatttttatt ttcttagtat gactttgcaa ggtttaccct ttgaaatcaa
     2101 tatttcagca atcgaatccg ctctctcccc agtcatcgtc atcgga
//